Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
Nintendo Switch Skin's Store 4
Dragon Ball decal skin for Nintendo Switch Console and Con..
Dragon Ball decal skin for Nintendo Switch Console and Con..
$22.00
Dragon Ball decal skin for Nintendo Switch Console and Con..
Dragon Ball decal skin for Nintendo Switch Console and Con..
$22.00
Dragon Ball decal skin for Nintendo Switch Console and Con..
Dragon Ball decal skin for Nintendo Switch Console and Con..
$22.00
Dragon Quest 11 decal skin for Nintendo Switch Console and..
Dragon Quest 11 decal skin for Nintendo Switch Console and..
$22.00
Dragon Quest 11 decal skin for Nintendo Switch Console and..
Dragon Quest 11 decal skin for Nintendo Switch Console and..
$22.00
Dragon Quest X decal skin for Nintendo Switch Console and ..
Dragon Quest X decal skin for Nintendo Switch Console and ..
$22.00
Fairy tail decal skin for Nintendo Switch Console and Cont..
Fairy tail decal skin for Nintendo Switch Console and Cont..
$22.00
Fairy tail decal skin for Nintendo Switch Console and Cont..
Fairy tail decal skin for Nintendo Switch Console and Cont..
$22.00
Fairy tail decal skin for Nintendo Switch Console and Cont..
Fairy tail decal skin for Nintendo Switch Console and Cont..
$22.00
Fairy tail decal skin for Nintendo Switch Console and Cont..
Fairy tail decal skin for Nintendo Switch Console and Cont..
$22.00
Fairy tail decal skin for Nintendo Switch Console and Cont..
Fairy tail decal skin for Nintendo Switch Console and Cont..
$22.00
Fairy tail dragon decal skin for Nintendo Switch Console a..
Fairy tail dragon decal skin for Nintendo Switch Console a..
$22.00
Fairy tail Gray decal skin for Nintendo Switch Console and..
Fairy tail Gray decal skin for Nintendo Switch Console and..
$22.00
Fairy tail Gray decal skin for Nintendo Switch Console and..
Fairy tail Gray decal skin for Nintendo Switch Console and..
$22.00
Fairy tail Gray decal skin for Nintendo Switch Console and..
Fairy tail Gray decal skin for Nintendo Switch Console and..
$22.00
Fairy tail Gray decal skin for Nintendo Switch Console and..
Fairy tail Gray decal skin for Nintendo Switch Console and..
$22.00
FC Barcelona decal skin for Nintendo Switch Console and Co..
FC Barcelona decal skin for Nintendo Switch Console and Co..
$22.00
FC Bayern Munchen decal skin for Nintendo Switch Console a..
FC Bayern Munchen decal skin for Nintendo Switch Console a..
$22.00
FC Porto decal skin for Nintendo Switch Console and Contro..
FC Porto decal skin for Nintendo Switch Console and Contro..
$22.00
FCB Messi decal skin for Nintendo Switch Console and Contr..
FCB Messi decal skin for Nintendo Switch Console and Contr..
$22.00
FIFA 20 decal skin for Nintendo Switch Console and Control..
FIFA 20 decal skin for Nintendo Switch Console and Control..
$22.00
FIFA 20 decal skin for Nintendo Switch Console and Control..
FIFA 20 decal skin for Nintendo Switch Console and Control..
$22.00
FIFA 20 decal skin for Nintendo Switch Console and Control..
FIFA 20 decal skin for Nintendo Switch Console and Control..
$22.00
FIFA 20 decal skin for Nintendo Switch Console and Control..
FIFA 20 decal skin for Nintendo Switch Console and Control..
$22.00
FIFA 20 decal skin for Nintendo Switch Console and Control..
FIFA 20 decal skin for Nintendo Switch Console and Control..
$22.00
FIFA 20 decal skin for Nintendo Switch Console and Control..
FIFA 20 decal skin for Nintendo Switch Console and Control..
$22.00
Fire Emblem Awakening decal skin for Nintendo Switch Conso..
Fire Emblem Awakening decal skin for Nintendo Switch Conso..
$22.00
Fire Emblem three houses decal skin for Nintendo Switch Co..
Fire Emblem three houses decal skin for Nintendo Switch Co..
$22.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i