Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Pro Skins
PS4 Pro Skin's Store PS4 Pro Skin's Store 2 PS4 Pro Skin's Store 3 PS4 Pro Skin's Store 4 PS4 Pro Skin's Store 5 PS4 Pro Skin's Store 6 PS4 Pro Skin's Store 7 PS4 Pro Skin's Store 8
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
Titanfall 2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Toro Inoue decal skin for PS4 Pro Console and 2 Controllers
Toro Inoue decal skin for PS4 Pro Console and 2 Controllers
$24.00
Tottenham Hotspur FC decal skin for PS4 Pro Console and 2 ..
Tottenham Hotspur FC decal skin for PS4 Pro Console and 2 ..
$24.00
Trabzonspor sk decal skin for PS4 Pro Console and 2 Contro..
Trabzonspor sk decal skin for PS4 Pro Console and 2 Contro..
$24.00
Turkey National Team decal skin for PS4 Pro Console and 2 ..
Turkey National Team decal skin for PS4 Pro Console and 2 ..
$24.00
UK Flag decal skin for PS4 Pro Console and 2 Controllers
UK Flag decal skin for PS4 Pro Console and 2 Controllers
$24.00
Unbowed, Unbent, Unbroken decal skin for PS4 Pro Console a..
Unbowed, Unbent, Unbroken decal skin for PS4 Pro Console a..
$24.00
Uncharted 4 decal skin for PS4 Pro Console and 2 Controllers
Uncharted 4 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Uncharted 4 decal skin for PS4 Pro Console and 2 Controllers
Uncharted 4 decal skin for PS4 Pro Console and 2 Controllers
$24.00
USA Flag decal skin for PS4 Pro Console and 2 Controllers
USA Flag decal skin for PS4 Pro Console and 2 Controllers
$24.00
Various Signs decal skin for PS4 Pro Console and 2 Control..
Various Signs decal skin for PS4 Pro Console and 2 Control..
$24.00
Various Sticker decal skin for PS4 Pro Console and 2 Contr..
Various Sticker decal skin for PS4 Pro Console and 2 Contr..
$24.00
Walking Dead Skull decal skin for PS4 Pro Console and 2 Co..
Walking Dead Skull decal skin for PS4 Pro Console and 2 Co..
$24.00
Walsall FC decal skin for PS4 Pro Console and 2 Controllers
Walsall FC decal skin for PS4 Pro Console and 2 Controllers
$24.00
Watch Dog2 decal skin for PS4 Pro Console and 2 Controllers
Watch Dog2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Watch Dog2 decal skin for PS4 Pro Console and 2 Controllers
Watch Dog2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Watch Dog2 decal skin for PS4 Pro Console and 2 Controllers
Watch Dog2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Watch Dog2 decal skin for PS4 Pro Console and 2 Controllers
Watch Dog2 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Weed decal skin for PS4 Pro Console and 2 Controllers
Weed decal skin for PS4 Pro Console and 2 Controllers
$24.00
Weed Flowers decal skin for PS4 Pro Console and 2 Controll..
Weed Flowers decal skin for PS4 Pro Console and 2 Controll..
$24.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i