Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
Xbox Series S skins
Xbox Series S Skin's store
Samurai Warriors 5 decal skin for Xbox Series S Console an..
Samurai Warriors 5 decal skin for Xbox Series S Console an..
$23.00
Samurai Warriors 5 decal skin for Xbox Series S Console an..
Samurai Warriors 5 decal skin for Xbox Series S Console an..
$23.00
Rubbish Texhture decal skin for Xbox Series S Console and ..
Rubbish Texhture decal skin for Xbox Series S Console and ..
$23.00
Rubbish Texhture decal skin for Xbox Series S Console and ..
Rubbish Texhture decal skin for Xbox Series S Console and ..
$23.00
Rubbish Texhture decal skin for Xbox Series S Console and ..
Rubbish Texhture decal skin for Xbox Series S Console and ..
$23.00
Rose View decal skin for Xbox Series S Console and 2 Contr..
Rose View decal skin for Xbox Series S Console and 2 Contr..
$23.00
Resident Evil Village decal skin for Xbox Series S Console..
Resident Evil Village decal skin for Xbox Series S Console..
$23.00
Resident Evil Village decal skin for Xbox Series S Console..
Resident Evil Village decal skin for Xbox Series S Console..
$23.00
Resident Evil Village decal skin for Xbox Series S Console..
Resident Evil Village decal skin for Xbox Series S Console..
$23.00
Resident Evil Village decal skin for Xbox Series S Console..
Resident Evil Village decal skin for Xbox Series S Console..
$23.00
Resident Evil Village decal skin for Xbox Series S Console..
Resident Evil Village decal skin for Xbox Series S Console..
$23.00
Resident Evil Village decal skin for Xbox Series S Console..
Resident Evil Village decal skin for Xbox Series S Console..
$23.00
Resident Evil Village decal skin for Xbox Series S Console..
Resident Evil Village decal skin for Xbox Series S Console..
$23.00
Resident Evil 3 decal skin for Xbox Series S Console and 2..
Resident Evil 3 decal skin for Xbox Series S Console and 2..
$23.00
Resident Evil 3 decal skin for Xbox Series S Console and 2..
Resident Evil 3 decal skin for Xbox Series S Console and 2..
$23.00
Resident Evil 3 decal skin for Xbox Series S Console and 2..
Resident Evil 3 decal skin for Xbox Series S Console and 2..
$23.00
Resident Evil 2 decal skin for Xbox Series S Console and 2..
Resident Evil 2 decal skin for Xbox Series S Console and 2..
$23.00
Resident Evil 2 decal skin for Xbox Series S Console and 2..
Resident Evil 2 decal skin for Xbox Series S Console and 2..
$23.00
Resident Evil 2 decal skin for Xbox Series S Console and 2..
Resident Evil 2 decal skin for Xbox Series S Console and 2..
$23.00
Resident Evil 2 decal skin for Xbox Series S Console and 2..
Resident Evil 2 decal skin for Xbox Series S Console and 2..
$23.00
Resident Evil 2 decal skin for Xbox Series S Console and 2..
Resident Evil 2 decal skin for Xbox Series S Console and 2..
$23.00
Resident Evil 2 decal skin for Xbox Series S Console and 2..
Resident Evil 2 decal skin for Xbox Series S Console and 2..
$23.00
Resident Evil 2 decal skin for Xbox Series S Console and 2..
Resident Evil 2 decal skin for Xbox Series S Console and 2..
$23.00
Resident Evil 2 decal skin for Xbox Series S Console and 2..
Resident Evil 2 decal skin for Xbox Series S Console and 2..
$23.00
Resident Evil 2 decal skin for Xbox Series S Console and 2..
Resident Evil 2 decal skin for Xbox Series S Console and 2..
$23.00
Red Texture decal skin for Xbox Series S Console and 2 Con..
Red Texture decal skin for Xbox Series S Console and 2 Con..
$23.00
Red Texture decal skin for Xbox Series S Console and 2 Con..
Red Texture decal skin for Xbox Series S Console and 2 Con..
$23.00
Red Texture decal skin for Xbox Series S Console and 2 Con..
Red Texture decal skin for Xbox Series S Console and 2 Con..
$23.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i