Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Pro Skins
PS4 Pro Skin's Store PS4 Pro Skin's Store 2 PS4 Pro Skin's Store 3 PS4 Pro Skin's Store 4 PS4 Pro Skin's Store 5 PS4 Pro Skin's Store 6 PS4 Pro Skin's Store 7 PS4 Pro Skin's Store 8
AC Milan 1899 decal skin for PS4 Pro Console and 2 Control..
AC Milan 1899 decal skin for PS4 Pro Console and 2 Control..
$24.00
AC Milan decal skin for PS4 Pro Console and 2 Controllers
AC Milan decal skin for PS4 Pro Console and 2 Controllers
$24.00
Air Jordan decal skin for PS4 Pro Console and 2 Controllers
Air Jordan decal skin for PS4 Pro Console and 2 Controllers
$24.00
Air Jordan decal skin for PS4 Pro Console and 2 Controllers
Air Jordan decal skin for PS4 Pro Console and 2 Controllers
$24.00
Air Jordan decal skin for PS4 Pro Console and 2 Controllers
Air Jordan decal skin for PS4 Pro Console and 2 Controllers
$24.00
Al Hilal FC decal skin for PS4 Pro Console and 2 Controllers
Al Hilal FC decal skin for PS4 Pro Console and 2 Controllers
$24.00
Al Hilal FC decal skin for PS4 Pro Console and 2 Controllers
Al Hilal FC decal skin for PS4 Pro Console and 2 Controllers
$24.00
Alien vs Predator decal skin for PS4 Pro Console and 2 Con..
Alien vs Predator decal skin for PS4 Pro Console and 2 Con..
$24.00
Alien VS Predator decal skin for PS4 Pro Console and 2 Con..
Alien VS Predator decal skin for PS4 Pro Console and 2 Con..
$24.00
Animated wolf decal skin for PS4 Pro Console and 2 Control..
Animated wolf decal skin for PS4 Pro Console and 2 Control..
$24.00
Anime Girl decal skin for PS4 Pro Console and 2 Controllers
Anime Girl decal skin for PS4 Pro Console and 2 Controllers
$24.00
Anime Girl decal skin for PS4 Pro Console and 2 Controllers
Anime Girl decal skin for PS4 Pro Console and 2 Controllers
$24.00
Anime Girl decal skin for PS4 Pro Console and 2 Controllers
Anime Girl decal skin for PS4 Pro Console and 2 Controllers
$24.00
Anime Girl decal skin for PS4 Pro Console and 2 Controllers
Anime Girl decal skin for PS4 Pro Console and 2 Controllers
$24.00
Anime Girl decal skin for PS4 Pro Console and 2 Controllers
Anime Girl decal skin for PS4 Pro Console and 2 Controllers
$24.00
Anime Girl decal skin for PS4 Pro Console and 2 Controllers
Anime Girl decal skin for PS4 Pro Console and 2 Controllers
$24.00
Anime Girl decal skin for PS4 Pro Console and 2 Controllers
Anime Girl decal skin for PS4 Pro Console and 2 Controllers
$24.00
Anime Girl decal skin for PS4 Pro Console and 2 Controllers
Anime Girl decal skin for PS4 Pro Console and 2 Controllers
$24.00
ARMIJA Military decal skin for PS4 Pro Console and 2 Contr..
ARMIJA Military decal skin for PS4 Pro Console and 2 Contr..
$24.00
Army Dress decal skin for PS4 Pro Console and 2 Controllers
Army Dress decal skin for PS4 Pro Console and 2 Controllers
$24.00
Army Dress decal skin for PS4 Pro Console and 2 Controllers
Army Dress decal skin for PS4 Pro Console and 2 Controllers
$24.00
Army Dress decal skin for PS4 Pro Console and 2 Controllers
Army Dress decal skin for PS4 Pro Console and 2 Controllers
$24.00
Arsenal decal skin for PS4 Pro Console and 2 Controllers
Arsenal decal skin for PS4 Pro Console and 2 Controllers
$24.00
Arsenal decal skin for PS4 Pro Console and 2 Controllers
Arsenal decal skin for PS4 Pro Console and 2 Controllers
$24.00
Arsenal Gunners decal skin for PS4 Pro Console and 2 Contr..
Arsenal Gunners decal skin for PS4 Pro Console and 2 Contr..
$24.00
Artificial Flower decal skin for PS4 Pro Console and 2 Con..
Artificial Flower decal skin for PS4 Pro Console and 2 Con..
$24.00
AS Roma decal skin for PS4 Pro Console and 2 Controllers
AS Roma decal skin for PS4 Pro Console and 2 Controllers
$24.00
Asiimov decal skin for PS4 Pro Console and 2 Controllers
Asiimov decal skin for PS4 Pro Console and 2 Controllers
$24.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i