Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Pro Skins
PS4 Pro Skin's Store PS4 Pro Skin's Store 2 PS4 Pro Skin's Store 3 PS4 Pro Skin's Store 4 PS4 Pro Skin's Store 5 PS4 Pro Skin's Store 6 PS4 Pro Skin's Store 7 PS4 Pro Skin's Store 8
Recep Tayyip Erdogan decal skin for PS4 Pro Console and 2 ..
Recep Tayyip Erdogan decal skin for PS4 Pro Console and 2 ..
$24.00
Real Madrid decal skin for PS4 Pro Console and 2 Controllers
Real Madrid decal skin for PS4 Pro Console and 2 Controllers
$24.00
Real Madrid decal skin for PS4 Pro Console and 2 Controllers
Real Madrid decal skin for PS4 Pro Console and 2 Controllers
$24.00
Real Madrid decal skin for PS4 Pro Console and 2 Controllers
Real Madrid decal skin for PS4 Pro Console and 2 Controllers
$24.00
Real Madrid decal skin for PS4 Pro Console and 2 Controllers
Real Madrid decal skin for PS4 Pro Console and 2 Controllers
$24.00
Real Madrid decal skin for PS4 Pro Console and 2 Controllers
Real Madrid decal skin for PS4 Pro Console and 2 Controllers
$24.00
Real Madrid decal skin for PS4 Pro Console and 2 Controllers
Real Madrid decal skin for PS4 Pro Console and 2 Controllers
$24.00
Real Madrid decal skin for PS4 Pro Console and 2 Controllers
Real Madrid decal skin for PS4 Pro Console and 2 Controllers
$24.00
Real Madrid decal skin for PS4 Pro Console and 2 Controllers
Real Madrid decal skin for PS4 Pro Console and 2 Controllers
$24.00
Real Madrid decal skin for PS4 Pro Console and 2 Controllers
Real Madrid decal skin for PS4 Pro Console and 2 Controllers
$24.00
Real Madrid decal skin for PS4 Pro Console and 2 Controllers
Real Madrid decal skin for PS4 Pro Console and 2 Controllers
$24.00
Real Madrid CF decal skin for PS4 Pro Console and 2 Contro..
Real Madrid CF decal skin for PS4 Pro Console and 2 Contro..
$24.00
Real Madrid CF decal skin for PS4 Pro Console and 2 Contro..
Real Madrid CF decal skin for PS4 Pro Console and 2 Contro..
$24.00
Real Madrid CF decal skin for PS4 Pro Console and 2 Contro..
Real Madrid CF decal skin for PS4 Pro Console and 2 Contro..
$24.00
Real Madrid CF decal skin for PS4 Pro Console and 2 Contro..
Real Madrid CF decal skin for PS4 Pro Console and 2 Contro..
$24.00
Real Madrid CF decal skin for PS4 Pro Console and 2 Contro..
Real Madrid CF decal skin for PS4 Pro Console and 2 Contro..
$24.00
Real Madrid CF decal skin for PS4 Pro Console and 2 Contro..
Real Madrid CF decal skin for PS4 Pro Console and 2 Contro..
$24.00
Real Madrid CF decal skin for PS4 Pro Console and 2 Contro..
Real Madrid CF decal skin for PS4 Pro Console and 2 Contro..
$24.00
Real Betis FC decal skin for PS4 Pro Console and 2 Control..
Real Betis FC decal skin for PS4 Pro Console and 2 Control..
$24.00
Radioactive art decal skin for PS4 Pro Console and 2 Contr..
Radioactive art decal skin for PS4 Pro Console and 2 Contr..
$24.00
Radioactive art decal skin for PS4 Pro Console and 2 Contr..
Radioactive art decal skin for PS4 Pro Console and 2 Contr..
$24.00
PS4 Station decal skin for PS4 Pro Console and 2 Controllers
PS4 Station decal skin for PS4 Pro Console and 2 Controllers
$24.00
PS4 Pro Board decal skin for PS4 Pro Console and 2 Control..
PS4 Pro Board decal skin for PS4 Pro Console and 2 Control..
$24.00
PS4 Button decal skin for PS4 Pro Console and 2 Controllers
PS4 Button decal skin for PS4 Pro Console and 2 Controllers
$24.00
Prismic Light action decal skin for PS4 Pro Console and 2 ..
Prismic Light action decal skin for PS4 Pro Console and 2 ..
$24.00
Pride in battle decal skin for PS4 Pro Console and 2 Contr..
Pride in battle decal skin for PS4 Pro Console and 2 Contr..
$24.00
Pouring Color decal skin for PS4 Pro Console and 2 Control..
Pouring Color decal skin for PS4 Pro Console and 2 Control..
$24.00
Pouring Color decal skin for PS4 Pro Console and 2 Control..
Pouring Color decal skin for PS4 Pro Console and 2 Control..
$24.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i