Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Pro Skin's Store 5
Supergirl decal skin for PS4 Pro Console and 2 Controllers
Supergirl decal skin for PS4 Pro Console and 2 Controllers
$24.00
Supergirl decal skin for PS4 Pro Console and 2 Controllers
Supergirl decal skin for PS4 Pro Console and 2 Controllers
$24.00
Supergirl decal skin for PS4 Pro Console and 2 Controllers
Supergirl decal skin for PS4 Pro Console and 2 Controllers
$24.00
Supergirl decal skin for PS4 Pro Console and 2 Controllers
Supergirl decal skin for PS4 Pro Console and 2 Controllers
$24.00
Supergirl decal skin for PS4 Pro Console and 2 Controllers
Supergirl decal skin for PS4 Pro Console and 2 Controllers
$24.00
Supergirl decal skin for PS4 Pro Console and 2 Controllers
Supergirl decal skin for PS4 Pro Console and 2 Controllers
$24.00
Supergirl decal skin for PS4 Pro Console and 2 Controllers
Supergirl decal skin for PS4 Pro Console and 2 Controllers
$24.00
Supergirl decal skin for PS4 Pro Console and 2 Controllers
Supergirl decal skin for PS4 Pro Console and 2 Controllers
$24.00
Supergirl decal skin for PS4 Pro Console and 2 Controllers
Supergirl decal skin for PS4 Pro Console and 2 Controllers
$24.00
Supreme decal skin for PS4 Pro Console and 2 Controllers
Supreme decal skin for PS4 Pro Console and 2 Controllers
$24.00
Supreme decal skin for PS4 Pro Console and 2 Controllers
Supreme decal skin for PS4 Pro Console and 2 Controllers
$24.00
Supreme decal skin for PS4 Pro Console and 2 Controllers
Supreme decal skin for PS4 Pro Console and 2 Controllers
$24.00
Supreme decal skin for PS4 Pro Console and 2 Controllers
Supreme decal skin for PS4 Pro Console and 2 Controllers
$24.00
Supreme decal skin for PS4 Pro Console and 2 Controllers
Supreme decal skin for PS4 Pro Console and 2 Controllers
$24.00
Supreme decal skin for PS4 Pro Console and 2 Controllers
Supreme decal skin for PS4 Pro Console and 2 Controllers
$24.00
Supreme decal skin for PS4 Pro Console and 2 Controllers
Supreme decal skin for PS4 Pro Console and 2 Controllers
$24.00
Tampa Bay Buccaneers decal skin for PS4 Pro Console and 2 ..
Tampa Bay Buccaneers decal skin for PS4 Pro Console and 2 ..
$24.00
Tampa Bay decal skin for PS4 Pro Console and 2 Controllers
Tampa Bay decal skin for PS4 Pro Console and 2 Controllers
$24.00
Tartan decal skin for PS4 Pro Console and 2 Controllers
Tartan decal skin for PS4 Pro Console and 2 Controllers
$24.00
Tech wallpaper decal skin for PS4 Pro Console and 2 Contro..
Tech wallpaper decal skin for PS4 Pro Console and 2 Contro..
$24.00
Tech wallpaper decal skin for PS4 Pro Console and 2 Contro..
Tech wallpaper decal skin for PS4 Pro Console and 2 Contro..
$24.00
Tech wallpaper decal skin for PS4 Pro Console and 2 Contro..
Tech wallpaper decal skin for PS4 Pro Console and 2 Contro..
$24.00
Tech wallpaper decal skin for PS4 Pro Console and 2 Contro..
Tech wallpaper decal skin for PS4 Pro Console and 2 Contro..
$24.00
Tech wallpaper decal skin for PS4 Pro Console and 2 Contro..
Tech wallpaper decal skin for PS4 Pro Console and 2 Contro..
$24.00
Tech wallpaper decal skin for PS4 Pro Console and 2 Contro..
Tech wallpaper decal skin for PS4 Pro Console and 2 Contro..
$24.00
Tech wallpaper decal skin for PS4 Pro Console and 2 Contro..
Tech wallpaper decal skin for PS4 Pro Console and 2 Contro..
$24.00
Tech wallpaper decal skin for PS4 Pro Console and 2 Contro..
Tech wallpaper decal skin for PS4 Pro Console and 2 Contro..
$24.00
Tech wallpaper decal skin for PS4 Pro Console and 2 Contro..
Tech wallpaper decal skin for PS4 Pro Console and 2 Contro..
$24.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i