Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Pro Skin's Store 8
Batman Gotham Knight decal skin for PS4 Pro Console and 2 ..
Batman Gotham Knight decal skin for PS4 Pro Console and 2 ..
$24.00
Batman Gotham Knight decal skin for PS4 Pro Console and 2 ..
Batman Gotham Knight decal skin for PS4 Pro Console and 2 ..
$24.00
Batman Gotham Knight decal skin for PS4 Pro Console and 2 ..
Batman Gotham Knight decal skin for PS4 Pro Console and 2 ..
$24.00
Batman decal skin for PS4 Pro Console and 2 Controllers
Batman decal skin for PS4 Pro Console and 2 Controllers
$24.00
Batman decal skin for PS4 Pro Console and 2 Controllers
Batman decal skin for PS4 Pro Console and 2 Controllers
$24.00
Batman decal skin for PS4 Pro Console and 2 Controllers
Batman decal skin for PS4 Pro Console and 2 Controllers
$24.00
Basketball decal skin for PS4 Pro Console and 2 Controllers
Basketball decal skin for PS4 Pro Console and 2 Controllers
$24.00
Attack on Titan decal skin for PS4 Pro Console and 2 Contr..
Attack on Titan decal skin for PS4 Pro Console and 2 Contr..
$24.00
Assassin's Creed 3 decal skin for PS4 Pro Console and 2 Co..
Assassin's Creed 3 decal skin for PS4 Pro Console and 2 Co..
$24.00
Arsenal decal skin for PS4 Pro Console and 2 Controllers
Arsenal decal skin for PS4 Pro Console and 2 Controllers
$24.00
Apex Legends decal skin for PS4 Pro Console and 2 Controll..
Apex Legends decal skin for PS4 Pro Console and 2 Controll..
$24.00
Anime decal skin for PS4 Pro Console and 2 Controllers
Anime decal skin for PS4 Pro Console and 2 Controllers
$24.00
Anime decal skin for PS4 Pro Console and 2 Controllers
Anime decal skin for PS4 Pro Console and 2 Controllers
$24.00
Anime decal skin for PS4 Pro Console and 2 Controllers
Anime decal skin for PS4 Pro Console and 2 Controllers
$24.00
Anime decal skin for PS4 Pro Console and 2 Controllers
Anime decal skin for PS4 Pro Console and 2 Controllers
$24.00
Anime decal skin for PS4 Pro Console and 2 Controllers
Anime decal skin for PS4 Pro Console and 2 Controllers
$24.00
Anime decal skin for PS4 Pro Console and 2 Controllers
Anime decal skin for PS4 Pro Console and 2 Controllers
$24.00
Anime decal skin for PS4 Pro Console and 2 Controllers
Anime decal skin for PS4 Pro Console and 2 Controllers
$24.00
Anime decal skin for PS4 Pro Console and 2 Controllers
Anime decal skin for PS4 Pro Console and 2 Controllers
$24.00
Anime decal skin for PS4 Pro Console and 2 Controllers
Anime decal skin for PS4 Pro Console and 2 Controllers
$24.00
Anime decal skin for PS4 Pro Console and 2 Controllers
Anime decal skin for PS4 Pro Console and 2 Controllers
$24.00
Anime decal skin for PS4 Pro Console and 2 Controllers
Anime decal skin for PS4 Pro Console and 2 Controllers
$24.00
Anime decal skin for PS4 Pro Console and 2 Controllers
Anime decal skin for PS4 Pro Console and 2 Controllers
$24.00
Anime decal skin for PS4 Pro Console and 2 Controllers
Anime decal skin for PS4 Pro Console and 2 Controllers
$24.00
Among us decal skin for PS4 Pro Console and 2 Controllers
Among us decal skin for PS4 Pro Console and 2 Controllers
$24.00
Al Nassr FC decal skin for PS4 Pro Console and 2 Controllers
Al Nassr FC decal skin for PS4 Pro Console and 2 Controllers
$24.00
Al Nassr FC decal skin for PS4 Pro Console and 2 Controllers
Al Nassr FC decal skin for PS4 Pro Console and 2 Controllers
$24.00
Al Nassr FC decal skin for PS4 Pro Console and 2 Controllers
Al Nassr FC decal skin for PS4 Pro Console and 2 Controllers
$24.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i