Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Pro Skin's Store 8
Darling in the Franxx decal skin for PS4 Pro Console and 2..
Darling in the Franxx decal skin for PS4 Pro Console and 2..
$24.00
Date A Live decal skin for PS4 Pro Console and 2 Controllers
Date A Live decal skin for PS4 Pro Console and 2 Controllers
$24.00
Date A Live Kurumi Tokisaki decal skin for PS4 Pro Console..
Date A Live Kurumi Tokisaki decal skin for PS4 Pro Console..
$24.00
Deadpool decal skin for PS4 Pro Console and 2 Controllers
Deadpool decal skin for PS4 Pro Console and 2 Controllers
$24.00
Deadpool decal skin for PS4 Pro Console and 2 Controllers
Deadpool decal skin for PS4 Pro Console and 2 Controllers
$24.00
Deadpool decal skin for PS4 Pro Console and 2 Controllers
Deadpool decal skin for PS4 Pro Console and 2 Controllers
$24.00
Death Stranding decal skin for PS4 Pro Console and 2 Contr..
Death Stranding decal skin for PS4 Pro Console and 2 Contr..
$24.00
Demon Slayer decal skin for PS4 Pro Console and 2 Controll..
Demon Slayer decal skin for PS4 Pro Console and 2 Controll..
$24.00
Demon Slayer decal skin for PS4 Pro Console and 2 Controll..
Demon Slayer decal skin for PS4 Pro Console and 2 Controll..
$24.00
Demon Slayer decal skin for PS4 Pro Console and 2 Controll..
Demon Slayer decal skin for PS4 Pro Console and 2 Controll..
$24.00
Demon Slayer decal skin for PS4 Pro Console and 2 Controll..
Demon Slayer decal skin for PS4 Pro Console and 2 Controll..
$24.00
Demon Slayer decal skin for PS4 Pro Console and 2 Controll..
Demon Slayer decal skin for PS4 Pro Console and 2 Controll..
$24.00
Demon Slayer decal skin for PS4 Pro Console and 2 Controll..
Demon Slayer decal skin for PS4 Pro Console and 2 Controll..
$24.00
Demon Slayer decal skin for PS4 Pro Console and 2 Controll..
Demon Slayer decal skin for PS4 Pro Console and 2 Controll..
$24.00
Demon Slayer decal skin for PS4 Pro Console and 2 Controll..
Demon Slayer decal skin for PS4 Pro Console and 2 Controll..
$24.00
Demon Slayer decal skin for PS4 Pro Console and 2 Controll..
Demon Slayer decal skin for PS4 Pro Console and 2 Controll..
$24.00
Demon Slayer decal skin for PS4 Pro Console and 2 Controll..
Demon Slayer decal skin for PS4 Pro Console and 2 Controll..
$24.00
Demon Slayer decal skin for PS4 Pro Console and 2 Controll..
Demon Slayer decal skin for PS4 Pro Console and 2 Controll..
$24.00
Demon Slayer decal skin for PS4 Pro Console and 2 Controll..
Demon Slayer decal skin for PS4 Pro Console and 2 Controll..
$24.00
Demon Slayer decal skin for PS4 Pro Console and 2 Controll..
Demon Slayer decal skin for PS4 Pro Console and 2 Controll..
$24.00
Devil May Cry 5 decal skin for PS4 Pro Console and 2 Contr..
Devil May Cry 5 decal skin for PS4 Pro Console and 2 Contr..
$24.00
Devil May Cry 5 decal skin for PS4 Pro Console and 2 Contr..
Devil May Cry 5 decal skin for PS4 Pro Console and 2 Contr..
$24.00
Diablo 4 decal skin for PS4 Pro Console and 2 Controllers
Diablo 4 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Diablo 4 decal skin for PS4 Pro Console and 2 Controllers
Diablo 4 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Diablo 4 decal skin for PS4 Pro Console and 2 Controllers
Diablo 4 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Diablo 4 decal skin for PS4 Pro Console and 2 Controllers
Diablo 4 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Diablo 4 decal skin for PS4 Pro Console and 2 Controllers
Diablo 4 decal skin for PS4 Pro Console and 2 Controllers
$24.00
Dishonored 2 decal skin for PS4 Pro Console and 2 Controll..
Dishonored 2 decal skin for PS4 Pro Console and 2 Controll..
$24.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i