Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skins
PS4 Slim Skins
PS4 Slim Skin's Store PS4 Slim Skin's Store 2 PS4 Slim Skin's Store 3 PS4 Slim Skin's Store 4 PS4 Slim Skin's Store 5 PS4 Slim Skin's Store 6 PS4 Slim Skin's Store 7 PS4 Slim Skin's Store 8 PS4 Slim Skin's Store 9
Leeds United FC decal skin for PS4 Slim Console and two co..
Leeds United FC decal skin for PS4 Slim Console and two co..
$23.00
Lego block decal skin for PS4 Slim Console and two control..
Lego block decal skin for PS4 Slim Console and two control..
$23.00
Lego Star Wars The Force Awakens decal skin for PS4 Slim C..
Lego Star Wars The Force Awakens decal skin for PS4 Slim C..
$23.00
Lie rabbits decal skin for PS4 Slim Console and two contro..
Lie rabbits decal skin for PS4 Slim Console and two contro..
$23.00
Lite yellow decal skin for PS4 Slim Console and two contro..
Lite yellow decal skin for PS4 Slim Console and two contro..
$23.00
Los Angeles Kings decal skin for PS4 Slim Console and two ..
Los Angeles Kings decal skin for PS4 Slim Console and two ..
$23.00
Los Angeles Rams decal skin for PS4 Slim Console and two c..
Los Angeles Rams decal skin for PS4 Slim Console and two c..
$23.00
Love wallpaper decal skin for PS4 Slim Console and two con..
Love wallpaper decal skin for PS4 Slim Console and two con..
$23.00
Machine hardware decal skin for PS4 Slim Console and two c..
Machine hardware decal skin for PS4 Slim Console and two c..
$23.00
Mafia 3 decal skin for PS4 Slim Console and two controllers
Mafia 3 decal skin for PS4 Slim Console and two controllers
$23.00
Mafia 3 decal skin for PS4 Slim Console and two controllers
Mafia 3 decal skin for PS4 Slim Console and two controllers
$23.00
Mafia 3 decal skin for PS4 Slim Console and two controllers
Mafia 3 decal skin for PS4 Slim Console and two controllers
$23.00
Mafia 3 the black mob decal skin for PS4 Slim Console and ..
Mafia 3 the black mob decal skin for PS4 Slim Console and ..
$23.00
Manchester City decal skin for PS4 Slim Console and two co..
Manchester City decal skin for PS4 Slim Console and two co..
$23.00
Manchester United decal skin for PS4 Slim Console and two ..
Manchester United decal skin for PS4 Slim Console and two ..
$23.00
Manchester United decal skin for PS4 Slim Console and two ..
Manchester United decal skin for PS4 Slim Console and two ..
$23.00
Men women decal skin for PS4 Slim Console and two controll..
Men women decal skin for PS4 Slim Console and two controll..
$23.00
Metal board decal skin for PS4 Slim Console and two contro..
Metal board decal skin for PS4 Slim Console and two contro..
$23.00
Metal floor decal skin for PS4 Slim Console and two contro..
Metal floor decal skin for PS4 Slim Console and two contro..
$23.00
Metal Gear Solid V the phantompain decal skin for PS4 Slim..
Metal Gear Solid V the phantompain decal skin for PS4 Slim..
$23.00
Metal skeleton decal skin for PS4 Slim Console and two con..
Metal skeleton decal skin for PS4 Slim Console and two con..
$23.00
Metal wall decal skin for PS4 Slim Console and two control..
Metal wall decal skin for PS4 Slim Console and two control..
$23.00
Miami Dolphins decal skin for PS4 Slim Console and two con..
Miami Dolphins decal skin for PS4 Slim Console and two con..
$23.00
Miami Dolphins decal skin for PS4 Slim Console and two con..
Miami Dolphins decal skin for PS4 Slim Console and two con..
$23.00
Miami Dolphins decal skin for PS4 Slim Console and two con..
Miami Dolphins decal skin for PS4 Slim Console and two con..
$23.00
Miami Marlins decal skin for PS4 Slim Console and two cont..
Miami Marlins decal skin for PS4 Slim Console and two cont..
$23.00
Minecraft decal skin for PS4 Slim Console and two controll..
Minecraft decal skin for PS4 Slim Console and two controll..
$23.00
Minnesota Vikings decal skin for PS4 Slim Console and two ..
Minnesota Vikings decal skin for PS4 Slim Console and two ..
$23.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i