Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skins
PS4 Slim Skins
PS4 Slim Skin's Store PS4 Slim Skin's Store 2 PS4 Slim Skin's Store 3 PS4 Slim Skin's Store 4 PS4 Slim Skin's Store 5 PS4 Slim Skin's Store 6 PS4 Slim Skin's Store 7 PS4 Slim Skin's Store 8 PS4 Slim Skin's Store 9
Bloodborne decal skin for PS4 Slim Console and two control..
Bloodborne decal skin for PS4 Slim Console and two control..
$23.00
Gin Tama decal skin for PS4 Slim Console and two controllers
Gin Tama decal skin for PS4 Slim Console and two controllers
$23.00
Anime Girl decal skin for PS4 Slim Console and two control..
Anime Girl decal skin for PS4 Slim Console and two control..
$23.00
Captain America decal skin for PS4 Slim Console and two co..
Captain America decal skin for PS4 Slim Console and two co..
$23.00
Kingdom of greece flag decal skin for PS4 Slim Console and..
Kingdom of greece flag decal skin for PS4 Slim Console and..
$23.00
Classic design decal skin for PS4 Slim Console and two con..
Classic design decal skin for PS4 Slim Console and two con..
$23.00
Doko demo issyo decal skin for PS4 Slim Console and two co..
Doko demo issyo decal skin for PS4 Slim Console and two co..
$23.00
Kumamon decal skin for PS4 Slim Console and two controllers
Kumamon decal skin for PS4 Slim Console and two controllers
$23.00
Kumamon decal skin for PS4 Slim Console and two controllers
Kumamon decal skin for PS4 Slim Console and two controllers
$23.00
Doko demo issyo decal skin for PS4 Slim Console and two co..
Doko demo issyo decal skin for PS4 Slim Console and two co..
$23.00
Gundam decal skin for PS4 Slim Console and two controllers
Gundam decal skin for PS4 Slim Console and two controllers
$23.00
Call of duty black ops 3 decal skin for PS4 Slim Console a..
Call of duty black ops 3 decal skin for PS4 Slim Console a..
$23.00
Kindom hearts decal skin for PS4 Slim Console and two cont..
Kindom hearts decal skin for PS4 Slim Console and two cont..
$23.00
Star wars decal skin for PS4 Slim Console and two controll..
Star wars decal skin for PS4 Slim Console and two controll..
$23.00
Winter Is Coming decal skin for PS4 Slim Console and two c..
Winter Is Coming decal skin for PS4 Slim Console and two c..
$23.00
Sticker bomb decal skin for PS4 Slim Console and two contr..
Sticker bomb decal skin for PS4 Slim Console and two contr..
$23.00
Resident evil wallpaper decal skin for PS4 Slim Console an..
Resident evil wallpaper decal skin for PS4 Slim Console an..
$23.00
Captain America decal skin for PS4 Slim Console and two co..
Captain America decal skin for PS4 Slim Console and two co..
$23.00
Naruto shippuden decal skin for PS4 Slim Console and two c..
Naruto shippuden decal skin for PS4 Slim Console and two c..
$23.00
Monster Engergy decal skin for PS4 Slim Console and two co..
Monster Engergy decal skin for PS4 Slim Console and two co..
$23.00
White Texture decal skin for PS4 Slim Console and two cont..
White Texture decal skin for PS4 Slim Console and two cont..
$23.00
Flag of Nazy decal skin for PS4 Slim Console and two contr..
Flag of Nazy decal skin for PS4 Slim Console and two contr..
$23.00
Superman Batman decal skin for PS4 Slim Console and two co..
Superman Batman decal skin for PS4 Slim Console and two co..
$23.00
Hatsune miku decal skin for PS4 Slim Console and two contr..
Hatsune miku decal skin for PS4 Slim Console and two contr..
$23.00
Hurtle hermit decal skin for PS4 Slim Console and two cont..
Hurtle hermit decal skin for PS4 Slim Console and two cont..
$23.00
Spiderman decal skin for PS4 Slim Console and two controll..
Spiderman decal skin for PS4 Slim Console and two controll..
$23.00
Gin Tama decal skin for PS4 Slim Console and two controllers
Gin Tama decal skin for PS4 Slim Console and two controllers
$23.00
Captain America decal skin for PS4 Slim Console and two co..
Captain America decal skin for PS4 Slim Console and two co..
$23.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i