Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skins
PS4 Slim Skins
PS4 Slim Skin's Store PS4 Slim Skin's Store 2 PS4 Slim Skin's Store 3 PS4 Slim Skin's Store 4 PS4 Slim Skin's Store 5 PS4 Slim Skin's Store 6 PS4 Slim Skin's Store 7 PS4 Slim Skin's Store 8 PS4 Slim Skin's Store 9
Harley Quin decal skin for PS4 Slim Console and two contro..
Harley Quin decal skin for PS4 Slim Console and two contro..
$23.00
Harley Quin decal skin for PS4 Slim Console and two contro..
Harley Quin decal skin for PS4 Slim Console and two contro..
$23.00
Dragon Ball Xenoverse decal skin for PS4 Slim Console and ..
Dragon Ball Xenoverse decal skin for PS4 Slim Console and ..
$23.00
Dragon ball super decal skin for PS4 Slim Console and two ..
Dragon ball super decal skin for PS4 Slim Console and two ..
$23.00
Dragon ball super decal skin for PS4 Slim Console and two ..
Dragon ball super decal skin for PS4 Slim Console and two ..
$23.00
Dragon ball super decal skin for PS4 Slim Console and two ..
Dragon ball super decal skin for PS4 Slim Console and two ..
$23.00
One Piece decal skin for PS4 Slim Console and two controll..
One Piece decal skin for PS4 Slim Console and two controll..
$23.00
Vault boy decal skin for PS4 Slim Console and two controll..
Vault boy decal skin for PS4 Slim Console and two controll..
$23.00
Metal Gear Solid V the phantompain decal skin for PS4 Slim..
Metal Gear Solid V the phantompain decal skin for PS4 Slim..
$23.00
Blood drops decal skin for PS4 Slim Console and two contro..
Blood drops decal skin for PS4 Slim Console and two contro..
$23.00
Assassins's Creed Syndicate decal skin for PS4 Slim Consol..
Assassins's Creed Syndicate decal skin for PS4 Slim Consol..
$23.00
Special vault boy decal skin for PS4 Slim Console and two ..
Special vault boy decal skin for PS4 Slim Console and two ..
$23.00
Special vault boy decal skin for PS4 Slim Console and two ..
Special vault boy decal skin for PS4 Slim Console and two ..
$23.00
Deadpool decal skin for PS4 Slim Console and two controllers
Deadpool decal skin for PS4 Slim Console and two controllers
$23.00
Deadpool decal skin for PS4 Slim Console and two controllers
Deadpool decal skin for PS4 Slim Console and two controllers
$23.00
Minecraft decal skin for PS4 Slim Console and two controll..
Minecraft decal skin for PS4 Slim Console and two controll..
$23.00
Nuka Cola Vault boy decal skin for PS4 Slim Console and tw..
Nuka Cola Vault boy decal skin for PS4 Slim Console and tw..
$23.00
Tom Clancy's Rainbow 6 Patriots decal skin for PS4 Slim Co..
Tom Clancy's Rainbow 6 Patriots decal skin for PS4 Slim Co..
$23.00
Tom Clancy's Rainbow Six Siege decal skin for PS4 Slim Con..
Tom Clancy's Rainbow Six Siege decal skin for PS4 Slim Con..
$23.00
Star wars decal skin for PS4 Slim Console and two controll..
Star wars decal skin for PS4 Slim Console and two controll..
$23.00
Star wars decal skin for PS4 Slim Console and two controll..
Star wars decal skin for PS4 Slim Console and two controll..
$23.00
Star wars decal skin for PS4 Slim Console and two controll..
Star wars decal skin for PS4 Slim Console and two controll..
$23.00
Star wars decal skin for PS4 Slim Console and two controll..
Star wars decal skin for PS4 Slim Console and two controll..
$23.00
Star wars decal skin for PS4 Slim Console and two controll..
Star wars decal skin for PS4 Slim Console and two controll..
$23.00
Fallout girl decal skin for PS4 Slim Console and two contr..
Fallout girl decal skin for PS4 Slim Console and two contr..
$23.00
Vault boy ice cool decal skin for PS4 Slim Console and two..
Vault boy ice cool decal skin for PS4 Slim Console and two..
$23.00
Tom Clancys the division decal skin for PS4 Slim Console a..
Tom Clancys the division decal skin for PS4 Slim Console a..
$23.00
Uncharted decal skin for PS4 Slim Console and two controll..
Uncharted decal skin for PS4 Slim Console and two controll..
$23.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i