Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skin's Store
AC milan decal skin for PS4 Slim Console and two controllers
AC milan decal skin for PS4 Slim Console and two controllers
$23.00
AC Milan decal skin for PS4 Slim Console and two controllers
AC Milan decal skin for PS4 Slim Console and two controllers
$23.00
AC Milan decal skin for PS4 Slim Console and two controllers
AC Milan decal skin for PS4 Slim Console and two controllers
$23.00
AC Milan decal skin for PS4 Slim Console and two controllers
AC Milan decal skin for PS4 Slim Console and two controllers
$23.00
Adidas decal skin for PS4 Slim Console and two controllers
Adidas decal skin for PS4 Slim Console and two controllers
$23.00
Adidas decal skin for PS4 Slim Console and two controllers
Adidas decal skin for PS4 Slim Console and two controllers
$23.00
Adidas decal skin for PS4 Slim Console and two controllers
Adidas decal skin for PS4 Slim Console and two controllers
$23.00
Adidas decal skin for PS4 Slim Console and two controllers
Adidas decal skin for PS4 Slim Console and two controllers
$23.00
Adidas decal skin for PS4 Slim Console and two controllers
Adidas decal skin for PS4 Slim Console and two controllers
$23.00
Air Jordan decal skin for PS4 Slim Console and two control..
Air Jordan decal skin for PS4 Slim Console and two control..
$23.00
Air Jordan decal skin for PS4 Slim Console and two control..
Air Jordan decal skin for PS4 Slim Console and two control..
$23.00
Air Jordan decal skin for PS4 Slim Console and two control..
Air Jordan decal skin for PS4 Slim Console and two control..
$23.00
Al Hilal FC decal skin for PS4 Slim Console and two contro..
Al Hilal FC decal skin for PS4 Slim Console and two contro..
$23.00
Alien decal skin for PS4 Slim Console and two controllers
Alien decal skin for PS4 Slim Console and two controllers
$23.00
Amsterdamsche FC decal skin for PS4 Slim Console and two c..
Amsterdamsche FC decal skin for PS4 Slim Console and two c..
$23.00
Animated Square pattern decal skin for PS4 Slim Console an..
Animated Square pattern decal skin for PS4 Slim Console an..
$23.00
Anime decal skin for PS4 Slim Console and two controllers
Anime decal skin for PS4 Slim Console and two controllers
$23.00
Anime Girl decal skin for PS4 Slim Console and two control..
Anime Girl decal skin for PS4 Slim Console and two control..
$23.00
Anime Girl decal skin for PS4 Slim Console and two control..
Anime Girl decal skin for PS4 Slim Console and two control..
$23.00
Anime Girl decal skin for PS4 Slim Console and two control..
Anime Girl decal skin for PS4 Slim Console and two control..
$23.00
Anime Girl decal skin for PS4 Slim Console and two control..
Anime Girl decal skin for PS4 Slim Console and two control..
$23.00
Anime Girl decal skin for PS4 Slim Console and two control..
Anime Girl decal skin for PS4 Slim Console and two control..
$23.00
Anime Girl decal skin for PS4 Slim Console and two control..
Anime Girl decal skin for PS4 Slim Console and two control..
$23.00
Anime reito decal skin for PS4 Slim Console and two contro..
Anime reito decal skin for PS4 Slim Console and two contro..
$23.00
Anime Sexy Girl decal skin for PS4 Slim Console and two co..
Anime Sexy Girl decal skin for PS4 Slim Console and two co..
$23.00
Arsenal decal skin for PS4 Slim Console and two controllers
Arsenal decal skin for PS4 Slim Console and two controllers
$23.00
Arsenal FC decal skin for PS4 Slim Console and two control..
Arsenal FC decal skin for PS4 Slim Console and two control..
$23.00
AS Roma decal skin for PS4 Slim Console and two controllers
AS Roma decal skin for PS4 Slim Console and two controllers
$23.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i