Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skin's Store 6
3D Abstract decal skin for PS4 Slim Console and two contro..
3D Abstract decal skin for PS4 Slim Console and two contro..
$23.00
3D Skulls decal skin for PS4 Slim Console and two controll..
3D Skulls decal skin for PS4 Slim Console and two controll..
$23.00
Abstraction decal skin for PS4 Slim Console and two contro..
Abstraction decal skin for PS4 Slim Console and two contro..
$23.00
Abstraction decal skin for PS4 Slim Console and two contro..
Abstraction decal skin for PS4 Slim Console and two contro..
$23.00
Abstraction decal skin for PS4 Slim Console and two contro..
Abstraction decal skin for PS4 Slim Console and two contro..
$23.00
Abstraction decal skin for PS4 Slim Console and two contro..
Abstraction decal skin for PS4 Slim Console and two contro..
$23.00
Abstraction decal skin for PS4 Slim Console and two contro..
Abstraction decal skin for PS4 Slim Console and two contro..
$23.00
Abstraction decal skin for PS4 Slim Console and two contro..
Abstraction decal skin for PS4 Slim Console and two contro..
$23.00
Abstraction decal skin for PS4 Slim Console and two contro..
Abstraction decal skin for PS4 Slim Console and two contro..
$23.00
Abstraction decal skin for PS4 Slim Console and two contro..
Abstraction decal skin for PS4 Slim Console and two contro..
$23.00
AC Milan decal skin for PS4 Slim Console and two controllers
AC Milan decal skin for PS4 Slim Console and two controllers
$23.00
ACE Combat 7 decal skin for PS4 Slim Console and two contr..
ACE Combat 7 decal skin for PS4 Slim Console and two contr..
$23.00
ACE Combat 7 decal skin for PS4 Slim Console and two contr..
ACE Combat 7 decal skin for PS4 Slim Console and two contr..
$23.00
ACE Combat 7 decal skin for PS4 Slim Console and two contr..
ACE Combat 7 decal skin for PS4 Slim Console and two contr..
$23.00
ACE Combat 7 decal skin for PS4 Slim Console and two contr..
ACE Combat 7 decal skin for PS4 Slim Console and two contr..
$23.00
ACE Combat 7 decal skin for PS4 Slim Console and two contr..
ACE Combat 7 decal skin for PS4 Slim Console and two contr..
$23.00
ACE Combat 7 decal skin for PS4 Slim Console and two contr..
ACE Combat 7 decal skin for PS4 Slim Console and two contr..
$23.00
ACE Combat 7 decal skin for PS4 Slim Console and two contr..
ACE Combat 7 decal skin for PS4 Slim Console and two contr..
$23.00
ACE Combat 7 decal skin for PS4 Slim Console and two contr..
ACE Combat 7 decal skin for PS4 Slim Console and two contr..
$23.00
ACE Combat 7 decal skin for PS4 Slim Console and two contr..
ACE Combat 7 decal skin for PS4 Slim Console and two contr..
$23.00
Adidas decal skin for PS4 Slim Console and two controllers
Adidas decal skin for PS4 Slim Console and two controllers
$23.00
Adidas decal skin for PS4 Slim Console and two controllers
Adidas decal skin for PS4 Slim Console and two controllers
$23.00
Air Jordan decal skin for PS4 Slim Console and two control..
Air Jordan decal skin for PS4 Slim Console and two control..
$23.00
AK 47 decal skin for PS4 Slim Console and two controllers
AK 47 decal skin for PS4 Slim Console and two controllers
$23.00
Amsterdam decal skin for PS4 Slim Console and two controll..
Amsterdam decal skin for PS4 Slim Console and two controll..
$23.00
Anime decal skin for PS4 Slim Console and two controllers
Anime decal skin for PS4 Slim Console and two controllers
$23.00
Anime decal skin for PS4 Slim Console and two controllers
Anime decal skin for PS4 Slim Console and two controllers
$23.00
Anime decal skin for PS4 Slim Console and two controllers
Anime decal skin for PS4 Slim Console and two controllers
$23.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i