Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skin's Store 7
COD Warzone decal skin for PS4 Slim Console and two contro..
COD Warzone decal skin for PS4 Slim Console and two contro..
$23.00
COD Warzone decal skin for PS4 Slim Console and two contro..
COD Warzone decal skin for PS4 Slim Console and two contro..
$23.00
COD Warzone decal skin for PS4 Slim Console and two contro..
COD Warzone decal skin for PS4 Slim Console and two contro..
$23.00
COD Warzone decal skin for PS4 Slim Console and two contro..
COD Warzone decal skin for PS4 Slim Console and two contro..
$23.00
Code Geass decal skin for PS4 Slim Console and two control..
Code Geass decal skin for PS4 Slim Console and two control..
$23.00
Colored decal skin for PS4 Slim Console and two controllers
Colored decal skin for PS4 Slim Console and two controllers
$23.00
Colored decal skin for PS4 Slim Console and two controllers
Colored decal skin for PS4 Slim Console and two controllers
$23.00
Colored decal skin for PS4 Slim Console and two controllers
Colored decal skin for PS4 Slim Console and two controllers
$23.00
Colorful flower decal skin for PS4 Slim Console and two co..
Colorful flower decal skin for PS4 Slim Console and two co..
$23.00
Control decal skin for PS4 Slim Console and two controllers
Control decal skin for PS4 Slim Console and two controllers
$23.00
Control decal skin for PS4 Slim Console and two controllers
Control decal skin for PS4 Slim Console and two controllers
$23.00
Control decal skin for PS4 Slim Console and two controllers
Control decal skin for PS4 Slim Console and two controllers
$23.00
Control decal skin for PS4 Slim Console and two controllers
Control decal skin for PS4 Slim Console and two controllers
$23.00
Control decal skin for PS4 Slim Console and two controllers
Control decal skin for PS4 Slim Console and two controllers
$23.00
Control decal skin for PS4 Slim Console and two controllers
Control decal skin for PS4 Slim Console and two controllers
$23.00
Cool Skull decal skin for PS4 Slim Console and two control..
Cool Skull decal skin for PS4 Slim Console and two control..
$23.00
Crash Team Racing Nitro-Fueled decal skin for PS4 Slim Con..
Crash Team Racing Nitro-Fueled decal skin for PS4 Slim Con..
$23.00
Cristiano Ronaldo decal skin for PS4 Slim Console and two ..
Cristiano Ronaldo decal skin for PS4 Slim Console and two ..
$23.00
Cyberpunk 2077 decal skin for PS4 Slim Console and two con..
Cyberpunk 2077 decal skin for PS4 Slim Console and two con..
$23.00
Cyberpunk 2077 decal skin for PS4 Slim Console and two con..
Cyberpunk 2077 decal skin for PS4 Slim Console and two con..
$23.00
Cyberpunk 2077 decal skin for PS4 Slim Console and two con..
Cyberpunk 2077 decal skin for PS4 Slim Console and two con..
$23.00
Cyberpunk 2077 decal skin for PS4 Slim Console and two con..
Cyberpunk 2077 decal skin for PS4 Slim Console and two con..
$23.00
Cyberpunk 2077 decal skin for PS4 Slim Console and two con..
Cyberpunk 2077 decal skin for PS4 Slim Console and two con..
$23.00
Cyberpunk 2077 decal skin for PS4 Slim Console and two con..
Cyberpunk 2077 decal skin for PS4 Slim Console and two con..
$23.00
Cyberpunk 2077 decal skin for PS4 Slim Console and two con..
Cyberpunk 2077 decal skin for PS4 Slim Console and two con..
$23.00
Cyberpunk 2077 decal skin for PS4 Slim Console and two con..
Cyberpunk 2077 decal skin for PS4 Slim Console and two con..
$23.00
Cyberpunk 2077 decal skin for PS4 Slim Console and two con..
Cyberpunk 2077 decal skin for PS4 Slim Console and two con..
$23.00
Cyberpunk 2077 decal skin for PS4 Slim Console and two con..
Cyberpunk 2077 decal skin for PS4 Slim Console and two con..
$23.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i