Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skin's Store 8
FIFA 22 decal skin for PS4 Slim Console and two controllers
FIFA 22 decal skin for PS4 Slim Console and two controllers
$23.00
FIFA 22 decal skin for PS4 Slim Console and two controllers
FIFA 22 decal skin for PS4 Slim Console and two controllers
$23.00
GTA 5 decal skin for PS4 Slim Console and two controllers
GTA 5 decal skin for PS4 Slim Console and two controllers
$23.00
Visible Girl decal skin for PS4 Slim Console and two contr..
Visible Girl decal skin for PS4 Slim Console and two contr..
$23.00
Visible Girl decal skin for PS4 Slim Console and two contr..
Visible Girl decal skin for PS4 Slim Console and two contr..
$23.00
Visible Girl decal skin for PS4 Slim Console and two contr..
Visible Girl decal skin for PS4 Slim Console and two contr..
$23.00
Visible Girl decal skin for PS4 Slim Console and two contr..
Visible Girl decal skin for PS4 Slim Console and two contr..
$23.00
One Piece decal skin for PS4 Slim Console and two controll..
One Piece decal skin for PS4 Slim Console and two controll..
$23.00
Reincarnation decal skin for PS4 Slim Console and two cont..
Reincarnation decal skin for PS4 Slim Console and two cont..
$23.00
Tokyo Avengers decal skin for PS4 Slim Console and two con..
Tokyo Avengers decal skin for PS4 Slim Console and two con..
$23.00
Tokyo Avengers decal skin for PS4 Slim Console and two con..
Tokyo Avengers decal skin for PS4 Slim Console and two con..
$23.00
Tokyo Avengers decal skin for PS4 Slim Console and two con..
Tokyo Avengers decal skin for PS4 Slim Console and two con..
$23.00
Tokyo Avengers decal skin for PS4 Slim Console and two con..
Tokyo Avengers decal skin for PS4 Slim Console and two con..
$23.00
Tokyo Avengers decal skin for PS4 Slim Console and two con..
Tokyo Avengers decal skin for PS4 Slim Console and two con..
$23.00
Tokyo Avengers decal skin for PS4 Slim Console and two con..
Tokyo Avengers decal skin for PS4 Slim Console and two con..
$23.00
Hitman decal skin for PS4 Slim Console and two controllers
Hitman decal skin for PS4 Slim Console and two controllers
$23.00
Hitman decal skin for PS4 Slim Console and two controllers
Hitman decal skin for PS4 Slim Console and two controllers
$23.00
Hitman decal skin for PS4 Slim Console and two controllers
Hitman decal skin for PS4 Slim Console and two controllers
$23.00
Hitman decal skin for PS4 Slim Console and two controllers
Hitman decal skin for PS4 Slim Console and two controllers
$23.00
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
$23.00
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
$23.00
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
$23.00
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
$23.00
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
$23.00
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
$23.00
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
$23.00
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
$23.00
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
$23.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i