Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PlayStation 4 Skins
PlayStation 4 Skins
PS4 Skin's Store PS4 Skin's Store 2 PS4 Skin's Store 3 PS4 Skin's Store 4 PS4 Skin's Store 5
Venom skin sticker for playstation 4 console and two contr..
Venom skin sticker for playstation 4 console and two contr..
$22.00
Venom skin sticker for playstation 4 console and two contr..
Venom skin sticker for playstation 4 console and two contr..
$22.00
Fallout 76 skin sticker for playstation 4 console and two ..
Fallout 76 skin sticker for playstation 4 console and two ..
$22.00
Assassins Creed Odyssey skin sticker for playstation 4 con..
Assassins Creed Odyssey skin sticker for playstation 4 con..
$22.00
Shadow of the tomb raider skin sticker for playstation 4 c..
Shadow of the tomb raider skin sticker for playstation 4 c..
$22.00
Red Dead Redemption 2 skin sticker for playstation 4 conso..
Red Dead Redemption 2 skin sticker for playstation 4 conso..
$22.00
PES 2019 skin sticker for playstation 4 console and two co..
PES 2019 skin sticker for playstation 4 console and two co..
$22.00
Fortnite skin sticker for playstation 4 console and two co..
Fortnite skin sticker for playstation 4 console and two co..
$22.00
Devil May Cry 5 skin sticker for playstation 4 console and..
Devil May Cry 5 skin sticker for playstation 4 console and..
$22.00
Assassins Creed Odyssey skin sticker for playstation 4 con..
Assassins Creed Odyssey skin sticker for playstation 4 con..
$22.00
Fortnite skin sticker for playstation 4 console and two co..
Fortnite skin sticker for playstation 4 console and two co..
$22.00
Fallout 76 skin sticker for playstation 4 console and two ..
Fallout 76 skin sticker for playstation 4 console and two ..
$22.00
Venom skin sticker for playstation 4 console and two contr..
Venom skin sticker for playstation 4 console and two contr..
$22.00
Venom skin sticker for playstation 4 console and two contr..
Venom skin sticker for playstation 4 console and two contr..
$22.00
Fortnite skin sticker for playstation 4 console and two co..
Fortnite skin sticker for playstation 4 console and two co..
$22.00
NBA 2K19 skin sticker for playstation 4 console and two co..
NBA 2K19 skin sticker for playstation 4 console and two co..
$22.00
FIFA 19 skin sticker for playstation 4 console and two con..
FIFA 19 skin sticker for playstation 4 console and two con..
$22.00
Reaction Guys skin sticker for playstation 4 console and ..
Reaction Guys skin sticker for playstation 4 console and ..
$22.00
Cyberpunk skin sticker for playstation 4 console and two c..
Cyberpunk skin sticker for playstation 4 console and two c..
$22.00
Cyberpunk skin sticker for playstation 4 console and two c..
Cyberpunk skin sticker for playstation 4 console and two c..
$22.00
Spider Man skin sticker for playstation 4 console and two ..
Spider Man skin sticker for playstation 4 console and two ..
$22.00
Super Smash Bros Ultimate skin sticker for playstation 4 c..
Super Smash Bros Ultimate skin sticker for playstation 4 c..
$22.00
Super Smash Bros Ultimate skin sticker for playstation 4 c..
Super Smash Bros Ultimate skin sticker for playstation 4 c..
$22.00
One Piece skin sticker for playstation 4 console and two c..
One Piece skin sticker for playstation 4 console and two c..
$22.00
Fortnite skin sticker for playstation 4 console and two co..
Fortnite skin sticker for playstation 4 console and two co..
$22.00
Fortnite battle royale skin sticker for playstation 4 cons..
Fortnite battle royale skin sticker for playstation 4 cons..
$22.00
Sekiro Shadows Die Twice skin sticker for playstation 4 co..
Sekiro Shadows Die Twice skin sticker for playstation 4 co..
$22.00
Sekiro Shadows Die Twice skin sticker for playstation 4 co..
Sekiro Shadows Die Twice skin sticker for playstation 4 co..
$22.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i