Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS5 Digital New Store
PS5 Digital New Store
PS5 Digital New Store 1 PS5 Digital New Store 2 PS5 Digital New Store 3
Tifa Lockhart decal skin for PS5 Digital Console and two C..
Tifa Lockhart decal skin for PS5 Digital Console and two C..
$25.00
Naruto decal skin for PS5 Digital Console and two Controll..
Naruto decal skin for PS5 Digital Console and two Controll..
$25.00
Naruto decal skin for PS5 Digital Console and two Controll..
Naruto decal skin for PS5 Digital Console and two Controll..
$25.00
Atelier Ryza decal skin for PS5 Digital Console and two Co..
Atelier Ryza decal skin for PS5 Digital Console and two Co..
$25.00
Atelier Ryza decal skin for PS5 Digital Console and two Co..
Atelier Ryza decal skin for PS5 Digital Console and two Co..
$25.00
Avengers decal skin for PS5 Digital Console and two Contro..
Avengers decal skin for PS5 Digital Console and two Contro..
$25.00
Controller Buttons decal skin for PS5 Digital Console and ..
Controller Buttons decal skin for PS5 Digital Console and ..
$25.00
Controller Buttons decal skin for PS5 Digital Console and ..
Controller Buttons decal skin for PS5 Digital Console and ..
$25.00
Controller Buttons decal skin for PS5 Digital Console and ..
Controller Buttons decal skin for PS5 Digital Console and ..
$25.00
Asuka Langly decal skin for PS5 Digital Console and two Co..
Asuka Langly decal skin for PS5 Digital Console and two Co..
$25.00
Harley Quinn decal skin for PS5 Digital Console and two Co..
Harley Quinn decal skin for PS5 Digital Console and two Co..
$25.00
One Piece decal skin for PS5 Digital Console and two Contr..
One Piece decal skin for PS5 Digital Console and two Contr..
$25.00
One Piece decal skin for PS5 Digital Console and two Contr..
One Piece decal skin for PS5 Digital Console and two Contr..
$25.00
One Piece decal skin for PS5 Digital Console and two Contr..
One Piece decal skin for PS5 Digital Console and two Contr..
$25.00
One Piece decal skin for PS5 Digital Console and two Contr..
One Piece decal skin for PS5 Digital Console and two Contr..
$25.00
Dragon Ball Goku decal skin for PS5 Digital Console and tw..
Dragon Ball Goku decal skin for PS5 Digital Console and tw..
$25.00
Dragon Ball Goku decal skin for PS5 Digital Console and tw..
Dragon Ball Goku decal skin for PS5 Digital Console and tw..
$25.00
Dragon Ball Goku decal skin for PS5 Digital Console and tw..
Dragon Ball Goku decal skin for PS5 Digital Console and tw..
$25.00
Dragon Ball Goku decal skin for PS5 Digital Console and tw..
Dragon Ball Goku decal skin for PS5 Digital Console and tw..
$25.00
Dragon Ball Goku decal skin for PS5 Digital Console and tw..
Dragon Ball Goku decal skin for PS5 Digital Console and tw..
$25.00
Tifa Lockhart decal skin for PS5 Digital Console and two C..
Tifa Lockhart decal skin for PS5 Digital Console and two C..
$25.00
Controllers Button decal skin for PS5 Digital Console and ..
Controllers Button decal skin for PS5 Digital Console and ..
$25.00
KAWS decal skin for PS5 Digital Console and two Controllers
KAWS decal skin for PS5 Digital Console and two Controllers
$25.00
Doraemon decal skin for PS5 Digital Console and two Contro..
Doraemon decal skin for PS5 Digital Console and two Contro..
$25.00
Doraemon decal skin for PS5 Digital Console and two Contro..
Doraemon decal skin for PS5 Digital Console and two Contro..
$25.00
Onepiece Zoro decal skin for PS5 Digital Console and two C..
Onepiece Zoro decal skin for PS5 Digital Console and two C..
$25.00
Onepiece Luffy decal skin for PS5 Digital Console and two ..
Onepiece Luffy decal skin for PS5 Digital Console and two ..
$25.00
Nier Automata decal skin for PS5 Digital Console and two C..
Nier Automata decal skin for PS5 Digital Console and two C..
$25.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i