Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS5 Digital New Store 1
God of War Kratos decal skin for PS5 Digital Console and t..
God of War Kratos decal skin for PS5 Digital Console and t..
$25.00
God of War Kratos decal skin for PS5 Digital Console and t..
God of War Kratos decal skin for PS5 Digital Console and t..
$25.00
God of War Kratos decal skin for PS5 Digital Console and t..
God of War Kratos decal skin for PS5 Digital Console and t..
$25.00
Halo 5 Guardians decal skin for PS5 Digital Console and tw..
Halo 5 Guardians decal skin for PS5 Digital Console and tw..
$25.00
Halo 5 Guardians decal skin for PS5 Digital Console and tw..
Halo 5 Guardians decal skin for PS5 Digital Console and tw..
$25.00
Halo 5 Guardians decal skin for PS5 Digital Console and tw..
Halo 5 Guardians decal skin for PS5 Digital Console and tw..
$25.00
Halo 5 Guardians decal skin for PS5 Digital Console and tw..
Halo 5 Guardians decal skin for PS5 Digital Console and tw..
$25.00
Halo 5 Guardians decal skin for PS5 Digital Console and tw..
Halo 5 Guardians decal skin for PS5 Digital Console and tw..
$25.00
Halo 5 Guardians decal skin for PS5 Digital Console and tw..
Halo 5 Guardians decal skin for PS5 Digital Console and tw..
$25.00
Halo decal skin for PS5 Digital Console and two Controllers
Halo decal skin for PS5 Digital Console and two Controllers
$25.00
Halo decal skin for PS5 Digital Console and two Controllers
Halo decal skin for PS5 Digital Console and two Controllers
$25.00
Halo decal skin for PS5 Digital Console and two Controllers
Halo decal skin for PS5 Digital Console and two Controllers
$25.00
Halo decal skin for PS5 Digital Console and two Controllers
Halo decal skin for PS5 Digital Console and two Controllers
$25.00
Halo decal skin for PS5 Digital Console and two Controllers
Halo decal skin for PS5 Digital Console and two Controllers
$25.00
Halo decal skin for PS5 Digital Console and two Controllers
Halo decal skin for PS5 Digital Console and two Controllers
$25.00
Halo Infinite decal skin for PS5 Digital Console and two C..
Halo Infinite decal skin for PS5 Digital Console and two C..
$25.00
Halo Infinite decal skin for PS5 Digital Console and two C..
Halo Infinite decal skin for PS5 Digital Console and two C..
$25.00
Halo Infinite decal skin for PS5 Digital Console and two C..
Halo Infinite decal skin for PS5 Digital Console and two C..
$25.00
Halo Infinite decal skin for PS5 Digital Console and two C..
Halo Infinite decal skin for PS5 Digital Console and two C..
$25.00
Halo Infinite decal skin for PS5 Digital Console and two C..
Halo Infinite decal skin for PS5 Digital Console and two C..
$25.00
Halo Infinite decal skin for PS5 Digital Console and two C..
Halo Infinite decal skin for PS5 Digital Console and two C..
$25.00
Halo Infinite decal skin for PS5 Digital Console and two C..
Halo Infinite decal skin for PS5 Digital Console and two C..
$25.00
Harley Joker decal skin for PS5 Digital Console and two Co..
Harley Joker decal skin for PS5 Digital Console and two Co..
$25.00
Harley Quinn decal skin for PS5 Digital Console and two Co..
Harley Quinn decal skin for PS5 Digital Console and two Co..
$25.00
Harley Quinn decal skin for PS5 Digital Console and two Co..
Harley Quinn decal skin for PS5 Digital Console and two Co..
$25.00
Harley Quinn decal skin for PS5 Digital Console and two Co..
Harley Quinn decal skin for PS5 Digital Console and two Co..
$25.00
Harley Quinn decal skin for PS5 Digital Console and two Co..
Harley Quinn decal skin for PS5 Digital Console and two Co..
$25.00
Harley Quinn decal skin for PS5 Digital Console and two Co..
Harley Quinn decal skin for PS5 Digital Console and two Co..
$25.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i