Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
Nintendo Switch Lite Skins
Nintendo Lite Skin's Store Nintendo Lite Skin's Store 2
The Witcher Wild Hunt decal skin Sticker for Nintendo Swit..
The Witcher Wild Hunt decal skin Sticker for Nintendo Swit..
$20.00
The Witcher Wild Hunt decal skin Sticker for Nintendo Swit..
The Witcher Wild Hunt decal skin Sticker for Nintendo Swit..
$20.00
Furry Texture decal skin Sticker for Nintendo Switch Lite ..
Furry Texture decal skin Sticker for Nintendo Switch Lite ..
$20.00
Luigi's Mansion decal skin Sticker for Nintendo Switch Lit..
Luigi's Mansion decal skin Sticker for Nintendo Switch Lit..
$20.00
Luigi's Mansion decal skin Sticker for Nintendo Switch Lit..
Luigi's Mansion decal skin Sticker for Nintendo Switch Lit..
$20.00
Dragon Quest 11 decal skin Sticker for Nintendo Switch Lit..
Dragon Quest 11 decal skin Sticker for Nintendo Switch Lit..
$20.00
Dragon Quest 11 decal skin Sticker for Nintendo Switch Lit..
Dragon Quest 11 decal skin Sticker for Nintendo Switch Lit..
$20.00
The Witcher Wild Hunt decal skin Sticker for Nintendo Swit..
The Witcher Wild Hunt decal skin Sticker for Nintendo Swit..
$20.00
The Witcher Wild Hunt decal skin Sticker for Nintendo Swit..
The Witcher Wild Hunt decal skin Sticker for Nintendo Swit..
$20.00
Luigi's Mansion decal skin Sticker for Nintendo Switch Lit..
Luigi's Mansion decal skin Sticker for Nintendo Switch Lit..
$20.00
Luigi's Mansion decal skin Sticker for Nintendo Switch Lit..
Luigi's Mansion decal skin Sticker for Nintendo Switch Lit..
$20.00
Animal Crossing decal skin Sticker for Nintendo Switch Lit..
Animal Crossing decal skin Sticker for Nintendo Switch Lit..
$20.00
Animal Crossing decal skin Sticker for Nintendo Switch Lit..
Animal Crossing decal skin Sticker for Nintendo Switch Lit..
$20.00
Pokemon Go decal skin Sticker for Nintendo Switch Lite Con..
Pokemon Go decal skin Sticker for Nintendo Switch Lite Con..
$20.00
Pokemon Go decal skin Sticker for Nintendo Switch Lite Con..
Pokemon Go decal skin Sticker for Nintendo Switch Lite Con..
$20.00
Pokemon Go decal skin Sticker for Nintendo Switch Lite Con..
Pokemon Go decal skin Sticker for Nintendo Switch Lite Con..
$20.00
Ha Ha Texture decal skin Sticker for Nintendo Switch Lite ..
Ha Ha Texture decal skin Sticker for Nintendo Switch Lite ..
$20.00
Color Texture decal skin Sticker for Nintendo Switch Lite ..
Color Texture decal skin Sticker for Nintendo Switch Lite ..
$20.00
Fortnite Battle Royale decal skin Sticker for Nintendo Swi..
Fortnite Battle Royale decal skin Sticker for Nintendo Swi..
$20.00
Fortnite Battle Royale decal skin Sticker for Nintendo Swi..
Fortnite Battle Royale decal skin Sticker for Nintendo Swi..
$20.00
Fortnite Battle Royale decal skin Sticker for Nintendo Swi..
Fortnite Battle Royale decal skin Sticker for Nintendo Swi..
$20.00
Fortnite Battle Royale decal skin Sticker for Nintendo Swi..
Fortnite Battle Royale decal skin Sticker for Nintendo Swi..
$20.00
Fortnite Battle Royale decal skin Sticker for Nintendo Swi..
Fortnite Battle Royale decal skin Sticker for Nintendo Swi..
$20.00
Fortnite Battle Royale decal skin Sticker for Nintendo Swi..
Fortnite Battle Royale decal skin Sticker for Nintendo Swi..
$20.00
Skull Texture decal skin Sticker for Nintendo Switch Lite ..
Skull Texture decal skin Sticker for Nintendo Switch Lite ..
$20.00
Skull Texture decal skin Sticker for Nintendo Switch Lite ..
Skull Texture decal skin Sticker for Nintendo Switch Lite ..
$20.00
Skull Texture decal skin Sticker for Nintendo Switch Lite ..
Skull Texture decal skin Sticker for Nintendo Switch Lite ..
$20.00
Super Mario decal skin Sticker for Nintendo Switch Lite Co..
Super Mario decal skin Sticker for Nintendo Switch Lite Co..
$20.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i