Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
Xbox One S skins
Xbox1 S Skin's store Xbox1 S Skin's store 2 Xbox1 S Skin's store 3 Xbox1 S Skin's store 4
Call of Duty infinite warfare decal skin for Xbox one S Co..
Call of Duty infinite warfare decal skin for Xbox one S Co..
$22.00
Call of Duty infinite warfare decal skin for Xbox one S Co..
Call of Duty infinite warfare decal skin for Xbox one S Co..
$22.00
Call of Duty infinite warfare decal skin for Xbox one S Co..
Call of Duty infinite warfare decal skin for Xbox one S Co..
$22.00
Call of Duty infinite warfare decal skin for Xbox one S Co..
Call of Duty infinite warfare decal skin for Xbox one S Co..
$22.00
Dragon Ball Xenoverse decal skin for Xbox one S Console an..
Dragon Ball Xenoverse decal skin for Xbox one S Console an..
$22.00
Fault Boy decal skin for Xbox one S Console and 2 Controll..
Fault Boy decal skin for Xbox one S Console and 2 Controll..
$22.00
Dragon Ball Xenoverse decal skin for Xbox one S Console an..
Dragon Ball Xenoverse decal skin for Xbox one S Console an..
$22.00
Dragon Ball Xenoverse decal skin for Xbox one S Console an..
Dragon Ball Xenoverse decal skin for Xbox one S Console an..
$22.00
Vault Boy decal skin for Xbox one S Console and 2 Controll..
Vault Boy decal skin for Xbox one S Console and 2 Controll..
$22.00
Vault Boy decal skin for Xbox one S Console and 2 Controll..
Vault Boy decal skin for Xbox one S Console and 2 Controll..
$22.00
Vault Boy decal skin for Xbox one S Console and 2 Controll..
Vault Boy decal skin for Xbox one S Console and 2 Controll..
$22.00
Vault Boy decal skin for Xbox one S Console and 2 Controll..
Vault Boy decal skin for Xbox one S Console and 2 Controll..
$22.00
FC Barcelona decal skin for Xbox one S Console and 2 Contr..
FC Barcelona decal skin for Xbox one S Console and 2 Contr..
$22.00
FIFA 17 decal skin for Xbox one S Console and 2 Controllers
FIFA 17 decal skin for Xbox one S Console and 2 Controllers
$22.00
FIFA 17 decal skin for Xbox one S Console and 2 Controllers
FIFA 17 decal skin for Xbox one S Console and 2 Controllers
$22.00
Manchester United decal skin for Xbox one S Console and 2 ..
Manchester United decal skin for Xbox one S Console and 2 ..
$22.00
Star wars decal skin for Xbox one S Console and 2 Controll..
Star wars decal skin for Xbox one S Console and 2 Controll..
$22.00
Deadpool decal skin for Xbox one S Console and 2 Controllers
Deadpool decal skin for Xbox one S Console and 2 Controllers
$22.00
Red Dead Redemption decal skin for Xbox one S Console and ..
Red Dead Redemption decal skin for Xbox one S Console and ..
$22.00
Red Dead Redemption decal skin for Xbox one S Console and ..
Red Dead Redemption decal skin for Xbox one S Console and ..
$22.00
Batman decal skin for Xbox one S Console and 2 Controllers
Batman decal skin for Xbox one S Console and 2 Controllers
$22.00
Black Row Style decal skin for Xbox one S Console and 2 Co..
Black Row Style decal skin for Xbox one S Console and 2 Co..
$22.00
Sticker bomb decal skin for Xbox one S Console and 2 Contr..
Sticker bomb decal skin for Xbox one S Console and 2 Contr..
$22.00
Lionel Messi decal skin for Xbox one S Console and 2 Contr..
Lionel Messi decal skin for Xbox one S Console and 2 Contr..
$22.00
Manchester United decal skin for Xbox one S Console and 2 ..
Manchester United decal skin for Xbox one S Console and 2 ..
$22.00
Manchester United decal skin for Xbox one S Console and 2 ..
Manchester United decal skin for Xbox one S Console and 2 ..
$22.00
Manchester United decal skin for Xbox one S Console and 2 ..
Manchester United decal skin for Xbox one S Console and 2 ..
$22.00
Manchester United decal skin for Xbox one S Console and 2 ..
Manchester United decal skin for Xbox one S Console and 2 ..
$22.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i