Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
Xbox One S skins
Xbox1 S Skin's store Xbox1 S Skin's store 2 Xbox1 S Skin's store 3 Xbox1 S Skin's store 4
Leopard wool decal skin for Xbox one S Console and 2 Contr..
Leopard wool decal skin for Xbox one S Console and 2 Contr..
$22.00
Leopard wool decal skin for Xbox one S Console and 2 Contr..
Leopard wool decal skin for Xbox one S Console and 2 Contr..
$22.00
Lionel Messi decal skin for Xbox one S Console and 2 Contr..
Lionel Messi decal skin for Xbox one S Console and 2 Contr..
$22.00
Lite red decal skin for Xbox one S Console and 2 Controllers
Lite red decal skin for Xbox one S Console and 2 Controllers
$22.00
Lite yellow decal skin for Xbox one S Console and 2 Contro..
Lite yellow decal skin for Xbox one S Console and 2 Contro..
$22.00
Lite yellow decal skin for Xbox one S Console and 2 Contro..
Lite yellow decal skin for Xbox one S Console and 2 Contro..
$22.00
Lite yellow decal skin for Xbox one S Console and 2 Contro..
Lite yellow decal skin for Xbox one S Console and 2 Contro..
$22.00
Liverpool decal skin for Xbox one S Console and 2 Controll..
Liverpool decal skin for Xbox one S Console and 2 Controll..
$22.00
Liverpool Football Club decal skin for Xbox one S Console ..
Liverpool Football Club decal skin for Xbox one S Console ..
$22.00
Liverpool Football Club decal skin for Xbox one S Console ..
Liverpool Football Club decal skin for Xbox one S Console ..
$22.00
Liverpool Football Club decal skin for Xbox one S Console ..
Liverpool Football Club decal skin for Xbox one S Console ..
$22.00
Los Angeles Angels decal skin for Xbox one S Console and 2..
Los Angeles Angels decal skin for Xbox one S Console and 2..
$22.00
Los Angeles Dodgers decal skin for Xbox one S Console and ..
Los Angeles Dodgers decal skin for Xbox one S Console and ..
$22.00
Los Angeles Kings decal skin for Xbox one S Console and 2 ..
Los Angeles Kings decal skin for Xbox one S Console and 2 ..
$22.00
Love wallpaper decal skin for Xbox one S Console and 2 Con..
Love wallpaper decal skin for Xbox one S Console and 2 Con..
$22.00
Mafia 3 the black mob decal skin for Xbox one S Console an..
Mafia 3 the black mob decal skin for Xbox one S Console an..
$22.00
Male and female decal skin for Xbox one S Console and 2 Co..
Male and female decal skin for Xbox one S Console and 2 Co..
$22.00
Manchester United decal skin for Xbox one S Console and 2 ..
Manchester United decal skin for Xbox one S Console and 2 ..
$22.00
Manchester United decal skin for Xbox one S Console and 2 ..
Manchester United decal skin for Xbox one S Console and 2 ..
$22.00
Manchester United decal skin for Xbox one S Console and 2 ..
Manchester United decal skin for Xbox one S Console and 2 ..
$22.00
Manchester United decal skin for Xbox one S Console and 2 ..
Manchester United decal skin for Xbox one S Console and 2 ..
$22.00
Manchester United decal skin for Xbox one S Console and 2 ..
Manchester United decal skin for Xbox one S Console and 2 ..
$22.00
Manchester United decal skin for Xbox one S Console and 2 ..
Manchester United decal skin for Xbox one S Console and 2 ..
$22.00
Manchester United decal skin for Xbox one S Console and 2 ..
Manchester United decal skin for Xbox one S Console and 2 ..
$22.00
Manchester United decal skin for Xbox one S Console and 2 ..
Manchester United decal skin for Xbox one S Console and 2 ..
$22.00
Manchester United decal skin for Xbox one S Console and 2 ..
Manchester United decal skin for Xbox one S Console and 2 ..
$22.00
Manchester United decal skin for Xbox one S Console and 2 ..
Manchester United decal skin for Xbox one S Console and 2 ..
$22.00
Mass Effect decal skin for Xbox one S Console and 2 Contro..
Mass Effect decal skin for Xbox one S Console and 2 Contro..
$22.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i