Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
Xbox Skins Store
Xbox1 Skins Store Xbox1 Skins Store 2 Xbox1 Skins Store 3 Xbox1 Skins Store 4 Xbox1 Skins Store 5
Street Fighter 4 Akuma decal skin for Xbox one Console and..
Street Fighter 4 Akuma decal skin for Xbox one Console and..
$22.00
Street Fighter 4 Alex decal skin for Xbox one Console and ..
Street Fighter 4 Alex decal skin for Xbox one Console and ..
$22.00
Street Fighter 4 Alex decal skin for Xbox one Console and ..
Street Fighter 4 Alex decal skin for Xbox one Console and ..
$22.00
Street Fighter 4 Cammy decal skin for Xbox one Console and..
Street Fighter 4 Cammy decal skin for Xbox one Console and..
$22.00
Street Fighter 4 Chun-Li decal skin for Xbox one Console a..
Street Fighter 4 Chun-Li decal skin for Xbox one Console a..
$22.00
Street Fighter 4 decal skin for Xbox one Console and 2 Con..
Street Fighter 4 decal skin for Xbox one Console and 2 Con..
$22.00
Street Fighter 4 decal skin for Xbox one Console and 2 Con..
Street Fighter 4 decal skin for Xbox one Console and 2 Con..
$22.00
Street Fighter 4 Guile decal skin for Xbox one Console and..
Street Fighter 4 Guile decal skin for Xbox one Console and..
$22.00
Street Fighter 4 Karin decal skin for Xbox one Console and..
Street Fighter 4 Karin decal skin for Xbox one Console and..
$22.00
Street Fighter 4 Ken decal skin for Xbox one Console and 2..
Street Fighter 4 Ken decal skin for Xbox one Console and 2..
$22.00
Street Fighter decal skin for Xbox one Console and 2 Contr..
Street Fighter decal skin for Xbox one Console and 2 Contr..
$22.00
Street Fighter decal skin for Xbox one Console and 2 Contr..
Street Fighter decal skin for Xbox one Console and 2 Contr..
$22.00
Street Fighter Vega decal skin for Xbox one Console and 2 ..
Street Fighter Vega decal skin for Xbox one Console and 2 ..
$22.00
Studio Ghibli decal skin for Xbox one Console and 2 Contro..
Studio Ghibli decal skin for Xbox one Console and 2 Contro..
$22.00
Sunderland afc decal skin for Xbox one Console and 2 Contr..
Sunderland afc decal skin for Xbox one Console and 2 Contr..
$22.00
Sunderland afc decal skin for Xbox one Console and 2 Contr..
Sunderland afc decal skin for Xbox one Console and 2 Contr..
$22.00
Sunderland afc decal skin for Xbox one Console and 2 Contr..
Sunderland afc decal skin for Xbox one Console and 2 Contr..
$22.00
Sunderland afc decal skin for Xbox one Console and 2 Contr..
Sunderland afc decal skin for Xbox one Console and 2 Contr..
$22.00
Sunderland afc decal skin for Xbox one Console and 2 Contr..
Sunderland afc decal skin for Xbox one Console and 2 Contr..
$22.00
Sunderland afc decal skin for Xbox one Console and 2 Contr..
Sunderland afc decal skin for Xbox one Console and 2 Contr..
$22.00
Super Mario Bros 1985 decal skin for Xbox one Console and ..
Super Mario Bros 1985 decal skin for Xbox one Console and ..
$22.00
Super villain decal skin for Xbox one Console and 2 Contro..
Super villain decal skin for Xbox one Console and 2 Contro..
$22.00
Superman decal skin for Xbox one Console and 2 Controllers
Superman decal skin for Xbox one Console and 2 Controllers
$22.00
Superman decal skin for Xbox one Console and 2 Controllers
Superman decal skin for Xbox one Console and 2 Controllers
$22.00
Superman decal skin for Xbox one Console and 2 Controllers
Superman decal skin for Xbox one Console and 2 Controllers
$22.00
Symmetra decal skin for Xbox one Console and 2 Controllers
Symmetra decal skin for Xbox one Console and 2 Controllers
$22.00
Teenage Mutant Ninja Turtles decal skin for Xbox one Conso..
Teenage Mutant Ninja Turtles decal skin for Xbox one Conso..
$22.00
Teenage Mutant Ninja Turtles decal skin for Xbox one Conso..
Teenage Mutant Ninja Turtles decal skin for Xbox one Conso..
$22.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i