Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
Xbox1 Skins Store 2
Green Camouflage decal skin for Xbox one Console and 2 Con..
Green Camouflage decal skin for Xbox one Console and 2 Con..
$22.00
Grand Theft Auto V decal skin for Xbox one Console and 2 C..
Grand Theft Auto V decal skin for Xbox one Console and 2 C..
$22.00
Grand Theft Auto V decal skin for Xbox one Console and 2 C..
Grand Theft Auto V decal skin for Xbox one Console and 2 C..
$22.00
Grand theft auto v decal skin for Xbox one Console and 2 ..
Grand theft auto v decal skin for Xbox one Console and 2 ..
$22.00
Grand theft auto san andreas decal skin for Xbox one Conso..
Grand theft auto san andreas decal skin for Xbox one Conso..
$22.00
Grand Theft auto five decal skin for Xbox one Console and ..
Grand Theft auto five decal skin for Xbox one Console and ..
$22.00
Grand Theft Auto Dora decal skin for Xbox one Console and ..
Grand Theft Auto Dora decal skin for Xbox one Console and ..
$22.00
Graffiti decal skin for Xbox one Console and 2 Controllers
Graffiti decal skin for Xbox one Console and 2 Controllers
$22.00
Graffiti decal skin for Xbox one Console and 2 Controllers
Graffiti decal skin for Xbox one Console and 2 Controllers
$22.00
Graffiti decal skin for Xbox one Console and 2 Controllers
Graffiti decal skin for Xbox one Console and 2 Controllers
$22.00
Graffiti decal skin for Xbox one Console and 2 Controllers
Graffiti decal skin for Xbox one Console and 2 Controllers
$22.00
Graffiti decal skin for Xbox one Console and 2 Controllers
Graffiti decal skin for Xbox one Console and 2 Controllers
$22.00
Graffiti decal skin for Xbox one Console and 2 Controllers
Graffiti decal skin for Xbox one Console and 2 Controllers
$22.00
Golden state warriors decal skin for Xbox one Console and ..
Golden state warriors decal skin for Xbox one Console and ..
$22.00
Golden state warriors decal skin for Xbox one Console and ..
Golden state warriors decal skin for Xbox one Console and ..
$22.00
Golden state warriors decal skin for Xbox one Console and ..
Golden state warriors decal skin for Xbox one Console and ..
$22.00
Golden state warriors decal skin for Xbox one Console and ..
Golden state warriors decal skin for Xbox one Console and ..
$22.00
Golden state warriors decal skin for Xbox one Console and ..
Golden state warriors decal skin for Xbox one Console and ..
$22.00
Golden state warriors decal skin for Xbox one Console and ..
Golden state warriors decal skin for Xbox one Console and ..
$22.00
Golden state warriors decal skin for Xbox one Console and ..
Golden state warriors decal skin for Xbox one Console and ..
$22.00
Golden state warriors decal skin for Xbox one Console and ..
Golden state warriors decal skin for Xbox one Console and ..
$22.00
Golden state warriors decal skin for Xbox one Console and ..
Golden state warriors decal skin for Xbox one Console and ..
$22.00
Golden state warriors decal skin for Xbox one Console and ..
Golden state warriors decal skin for Xbox one Console and ..
$22.00
Golden dragon decal skin for Xbox one Console and 2 Contr..
Golden dragon decal skin for Xbox one Console and 2 Contr..
$22.00
Gears of War decal skin for Xbox one Console and 2 Control..
Gears of War decal skin for Xbox one Console and 2 Control..
$22.00
Game of thrones decal skin for Xbox one Console and 2 Cont..
Game of thrones decal skin for Xbox one Console and 2 Cont..
$22.00
Game of thrones decal skin for Xbox one Console and 2 Cont..
Game of thrones decal skin for Xbox one Console and 2 Cont..
$22.00
Game of thrones decal skin for Xbox one Console and 2 Cont..
Game of thrones decal skin for Xbox one Console and 2 Cont..
$22.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i