Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
Xbox One X skins
Xbox1 X Skin's store Xbox1 X Skin's store 2 Xbox1 X Skin's store 3 Xbox1 X Skin's store 4 Xbox1 X Skin's store 5
Radioactive Logo decal skin for Xbox one X Console and 2 C..
Radioactive Logo decal skin for Xbox one X Console and 2 C..
$23.00
Red Dead Redemption 2 decal skin for Xbox one X Console an..
Red Dead Redemption 2 decal skin for Xbox one X Console an..
$23.00
Red decal skin for Xbox one X Console and 2 Controllers
Red decal skin for Xbox one X Console and 2 Controllers
$23.00
Red Leopard decal skin for Xbox one X Console and 2 Contro..
Red Leopard decal skin for Xbox one X Console and 2 Contro..
$23.00
Resident Evil 2 decal skin for Xbox one X Console and 2 Co..
Resident Evil 2 decal skin for Xbox one X Console and 2 Co..
$23.00
Resident Evil 7 decal skin for Xbox one X Console and 2 Co..
Resident Evil 7 decal skin for Xbox one X Console and 2 Co..
$23.00
Retro Robots decal skin for Xbox one X Console and 2 Contr..
Retro Robots decal skin for Xbox one X Console and 2 Contr..
$23.00
Retro Robots Graffiti decal skin for Xbox one X Console an..
Retro Robots Graffiti decal skin for Xbox one X Console an..
$23.00
Rise of the Tomb Raider decal skin for Xbox one X Console ..
Rise of the Tomb Raider decal skin for Xbox one X Console ..
$23.00
Rusted and Broken Brick wall decal skin for Xbox one X Con..
Rusted and Broken Brick wall decal skin for Xbox one X Con..
$23.00
Rusted Brick Wall decal skin for Xbox one X Console and 2 ..
Rusted Brick Wall decal skin for Xbox one X Console and 2 ..
$23.00
Rusted Brick Wall decal skin for Xbox one X Console and 2 ..
Rusted Brick Wall decal skin for Xbox one X Console and 2 ..
$23.00
Rusted stone wall decal skin for Xbox one X Console and 2 ..
Rusted stone wall decal skin for Xbox one X Console and 2 ..
$23.00
Rusted stone wall decal skin for Xbox one X Console and 2 ..
Rusted stone wall decal skin for Xbox one X Console and 2 ..
$23.00
Rusted stone wall decal skin for Xbox one X Console and 2 ..
Rusted stone wall decal skin for Xbox one X Console and 2 ..
$23.00
Rusted Wood Texture decal skin for Xbox one X Console and ..
Rusted Wood Texture decal skin for Xbox one X Console and ..
$23.00
Rusted Wood Texture decal skin for Xbox one X Console and ..
Rusted Wood Texture decal skin for Xbox one X Console and ..
$23.00
Rusted Wood Texture decal skin for Xbox one X Console and ..
Rusted Wood Texture decal skin for Xbox one X Console and ..
$23.00
San Andreas decal skin for Xbox one X Console and 2 Contro..
San Andreas decal skin for Xbox one X Console and 2 Contro..
$23.00
San Antonio Spurs decal skin for Xbox one X Console and 2 ..
San Antonio Spurs decal skin for Xbox one X Console and 2 ..
$23.00
Sexy Christmas Santa Girls decal skin for Xbox one X Conso..
Sexy Christmas Santa Girls decal skin for Xbox one X Conso..
$23.00
Sexy Girl Ass decal skin for Xbox one X Console and 2 Cont..
Sexy Girl Ass decal skin for Xbox one X Console and 2 Cont..
$23.00
Sexy Girl decal skin for Xbox one X Console and 2 Controll..
Sexy Girl decal skin for Xbox one X Console and 2 Controll..
$23.00
Sexy Girl decal skin for Xbox one X Console and 2 Controll..
Sexy Girl decal skin for Xbox one X Console and 2 Controll..
$23.00
Sexy Nude Girls decal skin for Xbox one X Console and 2 Co..
Sexy Nude Girls decal skin for Xbox one X Console and 2 Co..
$23.00
Shadow of War decal skin for Xbox one X Console and 2 Cont..
Shadow of War decal skin for Xbox one X Console and 2 Cont..
$23.00
Shadow of War decal skin for Xbox one X Console and 2 Cont..
Shadow of War decal skin for Xbox one X Console and 2 Cont..
$23.00
Silver Carbon Fiber decal skin for Xbox one X Console and ..
Silver Carbon Fiber decal skin for Xbox one X Console and ..
$23.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i