Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
Xbox One X skins
Xbox1 X Skin's store Xbox1 X Skin's store 2 Xbox1 X Skin's store 3 Xbox1 X Skin's store 4 Xbox1 X Skin's store 5
Star Wars decal skin for Xbox one X Console and 2 Controll..
Star Wars decal skin for Xbox one X Console and 2 Controll..
$23.00
Star Wars decal skin for Xbox one X Console and 2 Controll..
Star Wars decal skin for Xbox one X Console and 2 Controll..
$23.00
Star Wars decal skin for Xbox one X Console and 2 Controll..
Star Wars decal skin for Xbox one X Console and 2 Controll..
$23.00
Star Wars decal skin for Xbox one X Console and 2 Controll..
Star Wars decal skin for Xbox one X Console and 2 Controll..
$23.00
Call of Duty WW2 decal skin for Xbox one X Console and 2 C..
Call of Duty WW2 decal skin for Xbox one X Console and 2 C..
$23.00
Call of Duty WW2 decal skin for Xbox one X Console and 2 C..
Call of Duty WW2 decal skin for Xbox one X Console and 2 C..
$23.00
Call of Duty WW2 decal skin for Xbox one X Console and 2 C..
Call of Duty WW2 decal skin for Xbox one X Console and 2 C..
$23.00
Call of Duty WW2 decal skin for Xbox one X Console and 2 C..
Call of Duty WW2 decal skin for Xbox one X Console and 2 C..
$23.00
Call of Duty WW2 decal skin for Xbox one X Console and 2 C..
Call of Duty WW2 decal skin for Xbox one X Console and 2 C..
$23.00
Call of Duty WW2 decal skin for Xbox one X Console and 2 C..
Call of Duty WW2 decal skin for Xbox one X Console and 2 C..
$23.00
Call of Duty WW2 decal skin for Xbox one X Console and 2 C..
Call of Duty WW2 decal skin for Xbox one X Console and 2 C..
$23.00
Call of Duty WW2 decal skin for Xbox one X Console and 2 C..
Call of Duty WW2 decal skin for Xbox one X Console and 2 C..
$23.00
Call of Duty WW2 decal skin for Xbox one X Console and 2 C..
Call of Duty WW2 decal skin for Xbox one X Console and 2 C..
$23.00
Vintage Custom American Flag decal skin for Xbox one X Con..
Vintage Custom American Flag decal skin for Xbox one X Con..
$23.00
Grand Theft Auto V decal skin for Xbox one X Console and 2..
Grand Theft Auto V decal skin for Xbox one X Console and 2..
$23.00
Assassination Classroom decal skin for Xbox one X Console ..
Assassination Classroom decal skin for Xbox one X Console ..
$23.00
Spartak Moscow decal skin for Xbox one X Console and 2 Con..
Spartak Moscow decal skin for Xbox one X Console and 2 Con..
$23.00
Dragon Ball Super decal skin for Xbox one X Console and 2 ..
Dragon Ball Super decal skin for Xbox one X Console and 2 ..
$23.00
Bright Moon decal skin for Xbox one X Console and 2 Contro..
Bright Moon decal skin for Xbox one X Console and 2 Contro..
$23.00
Bursting Moon decal skin for Xbox one X Console and 2 Cont..
Bursting Moon decal skin for Xbox one X Console and 2 Cont..
$23.00
Bursting Moon decal skin for Xbox one X Console and 2 Cont..
Bursting Moon decal skin for Xbox one X Console and 2 Cont..
$23.00
Star Wars Black decal skin for Xbox one X Console and 2 Co..
Star Wars Black decal skin for Xbox one X Console and 2 Co..
$23.00
Star Wars decal skin for Xbox one X Console and 2 Controll..
Star Wars decal skin for Xbox one X Console and 2 Controll..
$23.00
Jigsaw decal skin for Xbox one X Console and 2 Controllers
Jigsaw decal skin for Xbox one X Console and 2 Controllers
$23.00
Jigsaw 7 decal skin for Xbox one X Console and 2 Controllers
Jigsaw 7 decal skin for Xbox one X Console and 2 Controllers
$23.00
Jigsaw decal skin for Xbox one X Console and 2 Controllers
Jigsaw decal skin for Xbox one X Console and 2 Controllers
$23.00
Jigsaw decal skin for Xbox one X Console and 2 Controllers
Jigsaw decal skin for Xbox one X Console and 2 Controllers
$23.00
Woodland Camouflage decal skin for Xbox one X Console and ..
Woodland Camouflage decal skin for Xbox one X Console and ..
$23.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i