Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
Xbox Series S Skin's store
TP Link decal skin for Xbox Series S Console and 2 Control..
TP Link decal skin for Xbox Series S Console and 2 Control..
$23.00
Venom decal skin for Xbox Series S Console and 2 Controllers
Venom decal skin for Xbox Series S Console and 2 Controllers
$23.00
Water Wave decal skin for Xbox Series S Console and 2 Cont..
Water Wave decal skin for Xbox Series S Console and 2 Cont..
$23.00
Weed Leaf decal skin for Xbox Series S Console and 2 Contr..
Weed Leaf decal skin for Xbox Series S Console and 2 Contr..
$23.00
Yuji Kaku decal skin for Xbox Series S Console and 2 Contr..
Yuji Kaku decal skin for Xbox Series S Console and 2 Contr..
$23.00
Yuji Kaku decal skin for Xbox Series S Console and 2 Contr..
Yuji Kaku decal skin for Xbox Series S Console and 2 Contr..
$23.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i