Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skins
PS4 Slim Skins
PS4 Slim Skin's Store PS4 Slim Skin's Store 2 PS4 Slim Skin's Store 3 PS4 Slim Skin's Store 4 PS4 Slim Skin's Store 5 PS4 Slim Skin's Store 6 PS4 Slim Skin's Store 7 PS4 Slim Skin's Store 8 PS4 Slim Skin's Store 9
Superman Batman decal skin for PS4 Slim Console and two co..
Superman Batman decal skin for PS4 Slim Console and two co..
$23.00
Sword Art Online decal skin for PS4 Slim Console and two c..
Sword Art Online decal skin for PS4 Slim Console and two c..
$23.00
Sword Art Online decal skin for PS4 Slim Console and two c..
Sword Art Online decal skin for PS4 Slim Console and two c..
$23.00
Tampa Bay Buccaneers decal skin for PS4 Slim Console and t..
Tampa Bay Buccaneers decal skin for PS4 Slim Console and t..
$23.00
Tennessee Titans decal skin for PS4 Slim Console and two c..
Tennessee Titans decal skin for PS4 Slim Console and two c..
$23.00
Tennessee Titans decal skin for PS4 Slim Console and two c..
Tennessee Titans decal skin for PS4 Slim Console and two c..
$23.00
The Celtic Football Club decal skin for PS4 Slim Console a..
The Celtic Football Club decal skin for PS4 Slim Console a..
$23.00
The Celtic Football Club decal skin for PS4 Slim Console a..
The Celtic Football Club decal skin for PS4 Slim Console a..
$23.00
The champion thresh decal skin for PS4 Slim Console and tw..
The champion thresh decal skin for PS4 Slim Console and tw..
$23.00
The Joker decal skin for PS4 Slim Console and two controll..
The Joker decal skin for PS4 Slim Console and two controll..
$23.00
The Joker decal skin for PS4 Slim Console and two controll..
The Joker decal skin for PS4 Slim Console and two controll..
$23.00
The Last of us decal skin for PS4 Slim Console and two con..
The Last of us decal skin for PS4 Slim Console and two con..
$23.00
The Last of us decal skin for PS4 Slim Console and two con..
The Last of us decal skin for PS4 Slim Console and two con..
$23.00
The Witcher 3 Wild Hunt decal skin for PS4 Slim Console an..
The Witcher 3 Wild Hunt decal skin for PS4 Slim Console an..
$23.00
Thunder lighting decal skin for PS4 Slim Console and two c..
Thunder lighting decal skin for PS4 Slim Console and two c..
$23.00
Titanfall 2 decal skin for PS4 Slim Console and two contro..
Titanfall 2 decal skin for PS4 Slim Console and two contro..
$23.00
Titanfall 2 decal skin for PS4 Slim Console and two contro..
Titanfall 2 decal skin for PS4 Slim Console and two contro..
$23.00
Titanfall 2 decal skin for PS4 Slim Console and two contro..
Titanfall 2 decal skin for PS4 Slim Console and two contro..
$23.00
Titanfall 2 decal skin for PS4 Slim Console and two contro..
Titanfall 2 decal skin for PS4 Slim Console and two contro..
$23.00
Titanfall 2 decal skin for PS4 Slim Console and two contro..
Titanfall 2 decal skin for PS4 Slim Console and two contro..
$23.00
Titanfall 2 decal skin for PS4 Slim Console and two contro..
Titanfall 2 decal skin for PS4 Slim Console and two contro..
$23.00
Titanfall 2 decal skin for PS4 Slim Console and two contro..
Titanfall 2 decal skin for PS4 Slim Console and two contro..
$23.00
Titanfall 2 decal skin for PS4 Slim Console and two contro..
Titanfall 2 decal skin for PS4 Slim Console and two contro..
$23.00
Titanfall 2 decal skin for PS4 Slim Console and two contro..
Titanfall 2 decal skin for PS4 Slim Console and two contro..
$23.00
Tokyo Ghoul decal skin for PS4 Slim Console and two contro..
Tokyo Ghoul decal skin for PS4 Slim Console and two contro..
$23.00
Tom Clancy's Rainbow 6 Patriots decal skin for PS4 Slim Co..
Tom Clancy's Rainbow 6 Patriots decal skin for PS4 Slim Co..
$23.00
Tom Clancy's Rainbow Six Siege decal skin for PS4 Slim Con..
Tom Clancy's Rainbow Six Siege decal skin for PS4 Slim Con..
$23.00
Tom Clancys the division decal skin for PS4 Slim Console a..
Tom Clancys the division decal skin for PS4 Slim Console a..
$23.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i