Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skins
PS4 Slim Skins
PS4 Slim Skin's Store PS4 Slim Skin's Store 2 PS4 Slim Skin's Store 3 PS4 Slim Skin's Store 4 PS4 Slim Skin's Store 5 PS4 Slim Skin's Store 6 PS4 Slim Skin's Store 7 PS4 Slim Skin's Store 8 PS4 Slim Skin's Store 9
Tom Clancy's the division decal skin for PS4 Slim Console ..
Tom Clancy's the division decal skin for PS4 Slim Console ..
$23.00
Tom Clancy's the division decal skin for PS4 Slim Console ..
Tom Clancy's the division decal skin for PS4 Slim Console ..
$23.00
Tom Clancy's the division decal skin for PS4 Slim Console ..
Tom Clancy's the division decal skin for PS4 Slim Console ..
$23.00
Toronto Raptors decal skin for PS4 Slim Console and two co..
Toronto Raptors decal skin for PS4 Slim Console and two co..
$23.00
Tottenham Hotspur FC decal skin for PS4 Slim Console and t..
Tottenham Hotspur FC decal skin for PS4 Slim Console and t..
$23.00
Toxic Wallpapers decal skin for PS4 Slim Console and two c..
Toxic Wallpapers decal skin for PS4 Slim Console and two c..
$23.00
Tree bark decal skin for PS4 Slim Console and two controll..
Tree bark decal skin for PS4 Slim Console and two controll..
$23.00
Tree colors decal skin for PS4 Slim Console and two contro..
Tree colors decal skin for PS4 Slim Console and two contro..
$23.00
Tree trunk decal skin for PS4 Slim Console and two control..
Tree trunk decal skin for PS4 Slim Console and two control..
$23.00
Tree trunk decal skin for PS4 Slim Console and two control..
Tree trunk decal skin for PS4 Slim Console and two control..
$23.00
Turkey Flag decal skin for PS4 Slim Console and two contro..
Turkey Flag decal skin for PS4 Slim Console and two contro..
$23.00
Turkey National Team decal skin for PS4 Slim Console and t..
Turkey National Team decal skin for PS4 Slim Console and t..
$23.00
UK Flag decal skin for PS4 Slim Console and two controllers
UK Flag decal skin for PS4 Slim Console and two controllers
$23.00
Uncharted 4 decal skin for PS4 Slim Console and two contro..
Uncharted 4 decal skin for PS4 Slim Console and two contro..
$23.00
Uncharted 4 decal skin for PS4 Slim Console and two contro..
Uncharted 4 decal skin for PS4 Slim Console and two contro..
$23.00
Uncharted 4 decal skin for PS4 Slim Console and two contro..
Uncharted 4 decal skin for PS4 Slim Console and two contro..
$23.00
Uncharted 4 decal skin for PS4 Slim Console and two contro..
Uncharted 4 decal skin for PS4 Slim Console and two contro..
$23.00
Uncharted 4 decal skin for PS4 Slim Console and two contro..
Uncharted 4 decal skin for PS4 Slim Console and two contro..
$23.00
Uncharted decal skin for PS4 Slim Console and two controll..
Uncharted decal skin for PS4 Slim Console and two controll..
$23.00
Universidad de chile decal skin for PS4 Slim Console and t..
Universidad de chile decal skin for PS4 Slim Console and t..
$23.00
Vancouver decal skin for PS4 Slim Console and two controll..
Vancouver decal skin for PS4 Slim Console and two controll..
$23.00
Vault boy decal skin for PS4 Slim Console and two controll..
Vault boy decal skin for PS4 Slim Console and two controll..
$23.00
Vault boy ice cool decal skin for PS4 Slim Console and two..
Vault boy ice cool decal skin for PS4 Slim Console and two..
$23.00
Walsall FC decal skin for PS4 Slim Console and two control..
Walsall FC decal skin for PS4 Slim Console and two control..
$23.00
Washington Capitals decal skin for PS4 Slim Console and tw..
Washington Capitals decal skin for PS4 Slim Console and tw..
$23.00
Washington Nationals decal skin for PS4 Slim Console and t..
Washington Nationals decal skin for PS4 Slim Console and t..
$23.00
Washington Redskins decal skin for PS4 Slim Console and tw..
Washington Redskins decal skin for PS4 Slim Console and tw..
$23.00
Washington Redskins decal skin for PS4 Slim Console and tw..
Washington Redskins decal skin for PS4 Slim Console and tw..
$23.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i