Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skins
PS4 Slim Skins
PS4 Slim Skin's Store PS4 Slim Skin's Store 2 PS4 Slim Skin's Store 3 PS4 Slim Skin's Store 4 PS4 Slim Skin's Store 5 PS4 Slim Skin's Store 6 PS4 Slim Skin's Store 7 PS4 Slim Skin's Store 8 PS4 Slim Skin's Store 9
Street Fighter V decal skin for PS4 Slim Console and two c..
Street Fighter V decal skin for PS4 Slim Console and two c..
$23.00
Sticker bomb decal skin for PS4 Slim Console and two contr..
Sticker bomb decal skin for PS4 Slim Console and two contr..
$23.00
Sticker bomb decal skin for PS4 Slim Console and two contr..
Sticker bomb decal skin for PS4 Slim Console and two contr..
$23.00
Sticker bomb decal skin for PS4 Slim Console and two contr..
Sticker bomb decal skin for PS4 Slim Console and two contr..
$23.00
Stephen Curry decal skin for PS4 Slim Console and two cont..
Stephen Curry decal skin for PS4 Slim Console and two cont..
$23.00
Stars fair decal skin for PS4 Slim Console and two control..
Stars fair decal skin for PS4 Slim Console and two control..
$23.00
Stars fair decal skin for PS4 Slim Console and two control..
Stars fair decal skin for PS4 Slim Console and two control..
$23.00
Starry sky decal skin for PS4 Slim Console and two control..
Starry sky decal skin for PS4 Slim Console and two control..
$23.00
Star wars Stormtrooper decal skin for PS4 Slim Console and..
Star wars Stormtrooper decal skin for PS4 Slim Console and..
$23.00
Star wars Stormtrooper decal skin for PS4 Slim Console and..
Star wars Stormtrooper decal skin for PS4 Slim Console and..
$23.00
Star wars Stormtrooper decal skin for PS4 Slim Console and..
Star wars Stormtrooper decal skin for PS4 Slim Console and..
$23.00
Star wars decal skin for PS4 Slim Console and two controll..
Star wars decal skin for PS4 Slim Console and two controll..
$23.00
Star wars decal skin for PS4 Slim Console and two controll..
Star wars decal skin for PS4 Slim Console and two controll..
$23.00
Star wars decal skin for PS4 Slim Console and two controll..
Star wars decal skin for PS4 Slim Console and two controll..
$23.00
Star wars decal skin for PS4 Slim Console and two controll..
Star wars decal skin for PS4 Slim Console and two controll..
$23.00
Star wars decal skin for PS4 Slim Console and two controll..
Star wars decal skin for PS4 Slim Console and two controll..
$23.00
Star wars decal skin for PS4 Slim Console and two controll..
Star wars decal skin for PS4 Slim Console and two controll..
$23.00
Star wars decal skin for PS4 Slim Console and two controll..
Star wars decal skin for PS4 Slim Console and two controll..
$23.00
Star wars decal skin for PS4 Slim Console and two controll..
Star wars decal skin for PS4 Slim Console and two controll..
$23.00
St Louis Blues decal skin for PS4 Slim Console and two con..
St Louis Blues decal skin for PS4 Slim Console and two con..
$23.00
Spiderman decal skin for PS4 Slim Console and two controll..
Spiderman decal skin for PS4 Slim Console and two controll..
$23.00
Special vault boy decal skin for PS4 Slim Console and two ..
Special vault boy decal skin for PS4 Slim Console and two ..
$23.00
Special vault boy decal skin for PS4 Slim Console and two ..
Special vault boy decal skin for PS4 Slim Console and two ..
$23.00
Sony PlayStation decal skin for PS4 Slim Console and two c..
Sony PlayStation decal skin for PS4 Slim Console and two c..
$23.00
Smoky skull decal skin for PS4 Slim Console and two contro..
Smoky skull decal skin for PS4 Slim Console and two contro..
$23.00
SL Benfica decal skin for PS4 Slim Console and two control..
SL Benfica decal skin for PS4 Slim Console and two control..
$23.00
Sky stars decal skin for PS4 Slim Console and two controll..
Sky stars decal skin for PS4 Slim Console and two controll..
$23.00
Sky scene decal skin for PS4 Slim Console and two controll..
Sky scene decal skin for PS4 Slim Console and two controll..
$23.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i