Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skins
PS4 Slim Skins
PS4 Slim Skin's Store PS4 Slim Skin's Store 2 PS4 Slim Skin's Store 3 PS4 Slim Skin's Store 4 PS4 Slim Skin's Store 5 PS4 Slim Skin's Store 6 PS4 Slim Skin's Store 7 PS4 Slim Skin's Store 8 PS4 Slim Skin's Store 9
Pink Glossy decal skin for PS4 Slim Console and two contro..
Pink Glossy decal skin for PS4 Slim Console and two contro..
$23.00
Philadelphia Flyers decal skin for PS4 Slim Console and tw..
Philadelphia Flyers decal skin for PS4 Slim Console and tw..
$23.00
Philadelphia Eagles decal skin for PS4 Slim Console and tw..
Philadelphia Eagles decal skin for PS4 Slim Console and tw..
$23.00
PFC CSKA Moscow decal skin for PS4 Slim Console and two co..
PFC CSKA Moscow decal skin for PS4 Slim Console and two co..
$23.00
Painted color decal skin for PS4 Slim Console and two cont..
Painted color decal skin for PS4 Slim Console and two cont..
$23.00
Painted color decal skin for PS4 Slim Console and two cont..
Painted color decal skin for PS4 Slim Console and two cont..
$23.00
Overwatch decal skin for PS4 Slim Console and two controll..
Overwatch decal skin for PS4 Slim Console and two controll..
$23.00
Overwatch decal skin for PS4 Slim Console and two controll..
Overwatch decal skin for PS4 Slim Console and two controll..
$23.00
Overwatch decal skin for PS4 Slim Console and two controll..
Overwatch decal skin for PS4 Slim Console and two controll..
$23.00
Overwatch decal skin for PS4 Slim Console and two controll..
Overwatch decal skin for PS4 Slim Console and two controll..
$23.00
Overwatch decal skin for PS4 Slim Console and two controll..
Overwatch decal skin for PS4 Slim Console and two controll..
$23.00
Overwatch decal skin for PS4 Slim Console and two controll..
Overwatch decal skin for PS4 Slim Console and two controll..
$23.00
Overwatch decal skin for PS4 Slim Console and two controll..
Overwatch decal skin for PS4 Slim Console and two controll..
$23.00
Overwatch decal skin for PS4 Slim Console and two controll..
Overwatch decal skin for PS4 Slim Console and two controll..
$23.00
Overwatch decal skin for PS4 Slim Console and two controll..
Overwatch decal skin for PS4 Slim Console and two controll..
$23.00
Overwatch decal skin for PS4 Slim Console and two controll..
Overwatch decal skin for PS4 Slim Console and two controll..
$23.00
One Piece decal skin for PS4 Slim Console and two controll..
One Piece decal skin for PS4 Slim Console and two controll..
$23.00
One Piece decal skin for PS4 Slim Console and two controll..
One Piece decal skin for PS4 Slim Console and two controll..
$23.00
One Piece Burning Blood decal skin for PS4 Slim Console an..
One Piece Burning Blood decal skin for PS4 Slim Console an..
$23.00
One Piece Burning Blood decal skin for PS4 Slim Console an..
One Piece Burning Blood decal skin for PS4 Slim Console an..
$23.00
One Piece Burning Blood decal skin for PS4 Slim Console an..
One Piece Burning Blood decal skin for PS4 Slim Console an..
$23.00
One Piece Burning Blood decal skin for PS4 Slim Console an..
One Piece Burning Blood decal skin for PS4 Slim Console an..
$23.00
Oakland Raiders decal skin for PS4 Slim Console and two co..
Oakland Raiders decal skin for PS4 Slim Console and two co..
$23.00
Oakland Raiders decal skin for PS4 Slim Console and two co..
Oakland Raiders decal skin for PS4 Slim Console and two co..
$23.00
NY Super bowl decal skin for PS4 Slim Console and two cont..
NY Super bowl decal skin for PS4 Slim Console and two cont..
$23.00
Nuka Cola Vault boy decal skin for PS4 Slim Console and tw..
Nuka Cola Vault boy decal skin for PS4 Slim Console and tw..
$23.00
Nude girls decal skin for PS4 Slim Console and two control..
Nude girls decal skin for PS4 Slim Console and two control..
$23.00
No man's sky decal skin for PS4 Slim Console and two contr..
No man's sky decal skin for PS4 Slim Console and two contr..
$23.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i